(data stored in ACNUC7421 zone)

EMBL: CP000438.OSMC

CP000438.OSMC        Location/Qualifiers
FT   CDS_pept        71112..71567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PA14_00710"
FT                   /product="osmotically inducible protein OsmC"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15016"
FT                   /db_xref="GOA:A0A0H2ZJ00"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ00"
FT                   /protein_id="ABJ15016.1"
FT                   /translation="MSIHSSGGVDMKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFN
FT                   TRFEGAPGTNPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAIT
FT                   AVHLVLRARVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
     atgtccatcc acagctccgg aggagtcgac atgaagaaga cggcatcggc ggtctggcaa        60
     ggcggcctga aagacggcaa gggcaccctt tccaccgaaa gcggcgcgct caaggacaac       120
     ccctatggct tcaatacccg cttcgagggc gcaccgggaa ccaacccgga agagctgatc       180
     ggcgcggccc acgccggctg cttcagcatg gccctgtcga tgatgctcgg cgaggccggc       240
     ctgaccgccg aacgtatcga gacccgcgcc gaggtcaccc tcgacaagca gtccgacggt       300
     ttcgccatca ctgccgtgca cctggtgctc agggcgcgcg tgccgggggc ggacgcgcag       360
     accttcgagc agatcgccaa caaggccaag gccggttgcc cggtatccaa ggtgctcaac       420
     gcgaagatca gcctggacgc cagcctcgac ggctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page