(data stored in ACNUC7421 zone)

EMBL: CP000438.OSTA

CP000438.OSTA        Location/Qualifiers
FT   CDS_pept        complement(666574..669348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /gene_synonym="imp"
FT                   /locus_tag="PA14_07770"
FT                   /product="organic solvent tolerance protein OstA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15559"
FT                   /db_xref="GOA:Q02TG8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TG8"
FT                   /protein_id="ABJ15559.1"
FT                   /translation="MAVKSLVFRRKFPLLVTGSLLALQPVAALTVQAADQFDCKVSATG
FT                   GWDCSPLQNANANLPPRPAHTATSVSTAAAGSSVSGSGGETVEAEPTQRLVTESGGRAL
FT                   RSRSADYSHLDWIPREKLTAAQLAEIGPYCGGSYIEPVRPGMDDGAPSDESPTYVSAKA
FT                   SRYEQEKQIATLAGDVVLRQGSMQVEGDEANLHQLENRGELVGNVKLRDKGMLVVGDHA
FT                   QVQLDNGEAQVDNAEYVIHKAHARGSALYAKRSENAIIMLKDGTYTRCEPSSNAWTLKG
FT                   NNVKLNPATGFGTATNATLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSSTSDTGFTL
FT                   VTPYYFNLAPNYDATLYPRYMAKRGMMLEGEFRYLTHSSEGIVNAAYLNDKDDHREGFP
FT                   DYSKDRWLYGLKNTTGLDSRWLAEVDYTRISDPYYFQDLDTDLGVGSTTYVNQRGTLTY
FT                   RGDTFTGRLNAQAYQLATTTDVTPYDRLPQITFDGFLPYNPGGMQFTYGTEFVRFDRDL
FT                   DENIYFNDDGSIRGKRPDASLQGLARATGDRMHLEPGMSLPMTRSWGYVTPTLKYLYTK
FT                   YDLDLDSQGKTDLNKRDESFDSNQDRSLPLVKVDSGLYFDRDTTFAGTPFRQTLEPRAM
FT                   YLYVPYKDQDSLPVFDTSEPSFSYDSLWRENRFTGKDRIGDANQLSLGVTSRFIEENGF
FT                   ERASISAGQIYYFRDRRVQLPGLTEKDLKRLNLDPSGLDNDSWRSPYAFAGQYRFNRDW
FT                   RINSDFNWNPNTSRTESGSAIFHYQPEVDPGKVVNVGYRYRADARRFDSSRGTFRYGNE
FT                   DDIIKQHDFSVIWPLVPQWSVLARWQYDYNKNRTLEAFGGFEYDSCCWKLRLINRYWLD
FT                   VDDDAFLVQSEKADRGIFLQIVLKGLGGIVGNKTEMFLDKGIQGYRQREDQAM"
     atggcagtga aatccctcgt gtttcgaaga aagtttcccc tgctggtcac cggcagcctg        60
     ctggctctgc agccggtcgc agcattgact gtacaggccg ccgatcagtt cgactgcaag       120
     gtatcggcca ccggcggctg ggattgctcc ccgctgcaga acgccaatgc caacctgcca       180
     ccgcgcccgg cgcataccgc gacctcggtc agcaccgccg cggcgggcag cagcgtgtcc       240
     ggcagcggag gcgaaaccgt cgaggcagag ccgacccagc gcctggtcac cgagtccggc       300
     ggtcgcgcgc tgagatcccg cagtgcggac tactcgcacc tcgactggat tcctcgggaa       360
     aaactgaccg ccgcccagtt ggcggaaatc ggcccctact gcggcggctc ctacatcgag       420
     ccggtgcgtc cgggcatgga tgacggcgcg cccagcgacg agagcccgac ctacgtatcc       480
     gccaaggctt cgcgctacga gcaggaaaaa cagatcgcca ccctcgccgg tgacgtggtc       540
     ctgcgccagg gcagcatgca ggtggaaggc gacgaggcca acctgcacca gctggaaaac       600
     cgcggcgaac tggtcggcaa cgtcaagctg cgcgacaagg gcatgctggt ggtcggcgac       660
     cacgcccagg tccagctgga caacggcgag gcccaggtcg acaacgccga gtacgtgatc       720
     cacaaggccc atgcccgcgg cagcgcgctc tacgccaagc gcagcgagaa cgccatcatc       780
     atgctcaagg atggcaccta cacccgctgc gaaccgagca gcaacgcctg gaccctgaag       840
     ggcaacaacg tcaagctgaa cccggccacc ggcttcggca ccgcgaccaa cgcgaccctg       900
     cgggtcaaag atttcccggt gttctacacc ccgtacatct atttcccgat cgacgaccgc       960
     cgccagtccg gtttcctgcc gccgagcttc agcagcacca gcgacaccgg cttcaccctg      1020
     gtcaccccgt actacttcaa cctggcgccg aactacgacg ccacgttgta cccgcgctac      1080
     atggccaagc gcggcatgat gctggaaggc gagttccgct acctgaccca cagcagcgaa      1140
     ggtatcgtca acgctgccta ccttaacgac aaggacgatc accgcgaagg tttcccggac      1200
     tacagcaagg accgctggct gtacggtctc aagaacacca ccggcctcga ttcgcgctgg      1260
     ctggccgagg tcgactacac gcggatcagt gatccctatt acttccagga tctggatact      1320
     gaccttggcg taggcagcac tacgtacgtc aaccaacggg gcactctgac ctatcgcggg      1380
     gacaccttta ctggccgttt gaatgcgcag gcgtaccagt tggcgaccac caccgatgta      1440
     accccgtacg accggctgcc acagattacc ttcgacggtt tcctgcccta caacccaggt      1500
     ggaatgcaat tcacctatgg caccgagttc gttcgattcg atcgagatct agacgaaaat      1560
     atctatttca atgacgacgg cagcatccgc ggcaaacgcc cagatgcgtc acttcaaggc      1620
     cttgcccgag caacgggaga ccgtatgcat ctggagccgg gcatgagttt gccaatgacg      1680
     cgcagctggg gttatgtgac acccacattg aaatatttgt atacaaagta cgatctagac      1740
     ttggatagcc agggcaagac cgacctgaat aaaagagatg agtcctttga cagcaatcag      1800
     gaccgttcgc tccctttggt taaggtcgac agcggcctgt atttcgaccg agacaccacc      1860
     tttgccggca caccattccg ccaaactctc gagccgcgtg ccatgtactt gtacgttcca      1920
     tataaggacc aagacagcct gccggtcttc gataccagtg aaccgtcctt cagttacgac      1980
     tctctgtggc gcgagaaccg ctttaccggt aaggatcgta tcggcgatgc caaccagttg      2040
     tccctgggcg tcaccagtcg tttcatcgaa gagaacggtt tcgaacgcgc cagcatcagt      2100
     gccggccaga tttactactt ccgtgatcgt cgcgtccaac taccaggcct aaccgagaag      2160
     gatctgaagc gactcaacct agatcccagc ggcttggaca atgacagctg gcgctctccc      2220
     tacgcctttg ccggccagta ccgtttcaac cgcgactggc gcatcaactc cgacttcaat      2280
     tggaacccca acaccagtcg tactgagtcc ggtagcgcca tcttccacta ccagcccgaa      2340
     gtcgatccgg gcaaggtggt caacgttggc tatcgctatc gtgcagatgc tcggcgcttt      2400
     gattcctccc gcggcacatt ccgatatggc aacgaagacg acatcatcaa acagcacgac      2460
     ttctcggtca tctggccgct ggtgccgcag tggtccgtgc tcgcccgctg gcagtacgac      2520
     tacaacaaga accgcacact cgaggccttc ggcggcttcg aatacgacag ctgctgctgg      2580
     aagctgcgcc tgatcaaccg ctactggctg gatgtggacg atgacgcctt cctcgtgcag      2640
     agcgagaagg ccgaccgcgg catcttcctg cagatcgtcc tgaagggcct cggcggcatc      2700
     gtaggcaaca agacggaaat gttcctcgac aaaggcatcc aaggttatcg tcaacgtgaa      2760
     gatcaagcta tgtaa                                                       2775
//

If you have problems or comments...

PBIL Back to PBIL home page