(data stored in ACNUC7421 zone)

EMBL: CP000438.PCAG

CP000438.PCAG        Location/Qualifiers
FT   CDS_pept        174354..174959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="PA14_01910"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15111"
FT                   /db_xref="GOA:A0A0H2ZK90"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK90"
FT                   /protein_id="ABJ15111.1"
FT                   /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMAREGA
FT                   PGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPERPFNSFGRTATTFDAGE
FT                   WTLHTVKPGVVRNAQGVPMAPHINVSLFARGINIHLQTRLYFDDETEANAACPVLNLIE
FT                   QAPRRDTLLARRCEVDGQLAYRFDIRIQGDNETVFFDF"
     atgagccacg aactgctgcg ggaaacccct tcccagaccg ccggtcccta cgtccacatc        60
     ggcctggcgc tggccgccgc cggcaacccg acccgcgacc tggagatctg gaaccgcatg       120
     gcccgcgaag gcgcgccggg ccagcacatc ctcctgctcg gccacgtcta cgacggcaac       180
     ggccacctgg tgcgcgactc gttcctggag ttctggcagg ccgacagcga aggccgctac       240
     caggagcgct acgatccgga gcgaccgttc aacagcttcg gccgcaccgc caccaccttc       300
     gatgccggcg agtggaccct gcacacggtc aagccggggg tggtgcgtaa cgcccagggc       360
     gtgccgatgg cgccgcacat caacgtctcg ctgttcgccc gcggcatcaa catccacttg       420
     cagacccggc tgtacttcga tgacgagacc gaggccaacg ccgcctgtcc ggtgctcaac       480
     ctgatcgagc aggcgccgcg tcgcgacacc ctgctcgcgc ggcgctgcga agtggacgga       540
     cagctcgcct accgtttcga catccgcatc cagggcgaca acgagacggt gttcttcgac       600
     ttctag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page