(data stored in ACNUC7421 zone)

EMBL: CP000438.PCAH

CP000438.PCAH        Location/Qualifiers
FT   CDS_pept        173624..174343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="PA14_01900"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15110"
FT                   /db_xref="GOA:A0A0H2ZJ87"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ87"
FT                   /protein_id="ABJ15110.1"
FT                   /translation="MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLS
FT                   ETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQAN
FT                   AGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPAHIH
FT                   VSVSGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPEAAQSLIGRLDMSMANPMDCLAY
FT                   RFDIVLRGQRKTFFENA"
     atgcacgacg ccgaaagccg tcgtttcgtc atccgtgacc gaaactggca ccccaaagcc        60
     ttgacccccg actacaagac ctccgtgccg cgctcgccga gccaggcgct ggtgagcatc       120
     ccgcaatcgc tctcggaaac cagcgggccg gacttctccc acctcaggct cggccgccac       180
     gacaacgacc tgctgctcaa cttcgaccac ggcggcctgc cccagggcga gcgcatcatc       240
     atgttcggcc gggtcttcga ccagtacggc aagccggtcc cgcacaccct ggtggagatg       300
     tggcaggcca acgccggcgg gcgctaccgg cacaagaacg accgctacct ggcgccgctc       360
     gacccgaact tcggcggcgt cggccggacc ctcaccgaca gcgagggcca ctattacttc       420
     cgcaccatca agcccgggcc ctatccctgg cgcaacggcc ccaacgactg gcgtccggcg       480
     cacatccacg tgtccgtcag cggcccggcg atcgccgcgc ggctggtcac ccagatgtac       540
     ttcgagggcg acccgctgat ccccaagtgc ccgatcatcc gcacccttgc cgacccggag       600
     gcggcgcaga gcctgatcgg ccggctcgac atgagcatgg ccaacccgat ggattgcctg       660
     gcctaccgct tcgacatcgt cctgcgcggg cagcgcaaga ccttcttcga gaacgcctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page