(data stored in ACNUC7421 zone)

EMBL: CP000438.PDXA

CP000438.PDXA        Location/Qualifiers
FT   CDS_pept        complement(664318..665304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="PA14_07740"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15557"
FT                   /db_xref="GOA:A0A0H2ZLL0"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLL0"
FT                   /protein_id="ABJ15557.1"
FT                   /translation="MSLRFALTPGEPAGIGPDLCLLLARSAQPHPLIAIASRTLLQERA
FT                   GQLGLAIYLKDVSPAAWPERPAKAGQLYVWDTPLAAPVRPGQLDRANAAYVLETLTRAG
FT                   QGCLDGHFAGMITAPVHKGVINEAGIPFSGHTEFLADLTHTAQVVMMLATRGLRVALAT
FT                   THLPLREVADAISDERLARVARILHADLRDKFGIAHPRILVCGLNPHAGEGGHLGREEI
FT                   EVIEPCLERLRGEGLDLIGPLPADTLFTPKHLEHCDAVLAMYHDQGLPVLKYKGFGAAV
FT                   NVTLGLPIIRTSVDHGTALDLAGSGRIDSGSLQVALETAYQMAASRC"
     gtgagcctgc gcttcgcgct cactcccggc gagccggcag gtatcggacc cgatctgtgc        60
     ctgctgctcg cccgctccgc ccagccccac cccctgatcg ccatcgccag ccgcacgctc       120
     ctgcaagagc gcgccggcca actgggcctg gcgatctacc ttaaggacgt ttccccggcc       180
     gcctggccag agcgaccggc caaggccggc caactgtacg tatgggatac gccgctggcc       240
     gccccggtcc gccccgggca attggaccgc gccaacgccg cctacgtcct ggaaaccctg       300
     acccgcgccg gccagggctg cctcgacggg cacttcgccg ggatgatcac cgcaccggtg       360
     cacaagggcg tgatcaacga agccggcatc cccttttccg gccataccga attcctcgcc       420
     gacctcaccc acaccgccca ggtggtgatg atgctggcca cccgcggcct gcgcgtggcc       480
     ctggcgacca cccacctgcc gctgcgcgag gtcgccgacg ccattagcga cgagcgcctg       540
     gcccgggtcg cgcgcatcct ccacgccgac ctgcgcgaca agttcggcat cgcccatccg       600
     cgcatcctgg tctgcggact caacccgcac gccggcgaag gcggtcacct ggggcgggaa       660
     gagatcgagg tgatcgaacc ctgcctcgag cgcctgcgtg gcgaaggcct cgacctgatc       720
     ggcccgctgc cggccgacac cctgttcact cccaagcacc tggagcattg cgacgcggtg       780
     ctggcgatgt accacgacca gggtctcccc gtgctcaagt acaagggctt cggtgccgcc       840
     gtgaacgtga ccctcggcct gccgatcatc cgcacctctg tcgaccacgg taccgccctc       900
     gacctggccg gaagcggccg catcgatagc ggcagcctgc aggtggccct ggaaaccgcc       960
     taccagatgg cggccagccg ctgctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page