(data stored in ACNUC7421 zone)

EMBL: CP000438.PE100

CP000438.PE100       Location/Qualifiers
FT   CDS_pept        115913..117112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15054"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA6"
FT                   /protein_id="ABJ15054.1"
FT                   /translation="MAPTSPAAPPGSTGSRAVRCRSTERGGPDMELLNATPLAAAYNQG
FT                   LDAEGRESLVVIAKGSFDLPLDGREARLLDEQQALLMVDEFYGEPGLSAPRRECEFVPF
FT                   KPFCDVLVLGSAQAPGGRPVQQLTAGIRVGRVSKALAVHGPRQWEPGLLGAGAGVAQPF
FT                   QRQDISYASAFGGSHASPDNPDFMDCYMANPAGCGWFPRSADTAEIVGTPMPATEKLGE
FT                   PVDSPHGRFTPMALGPLGRHWQARVGFAGRYDDAWLAERFPFLPADFDERYFQSAPADQ
FT                   WTDHLRGGEEVLLLNLTGEERAAFRVPRREVPVTFFLKKGGHETAQARIDTLLVDCDAR
FT                   RVEVTWRIRRPLKRNLFEIAQVLVGSKSAAWWRARELGKDYYPSLAALARSRQAEEDEA
FT                   "
     atggcgccta cctctccagc cgctccaccg gggtcaaccg gatcaagggc ggttcggtgc        60
     agatcaactg agcgcggcgg gccggacatg gaactgttga acgccacccc gctggccgcc       120
     gcctacaacc aggggctcga cgccgaaggc cgggagtcgc tggtggtgat cgccaagggc       180
     agtttcgacc tgccgctgga cggtcgcgag gcgcgcctgc tggacgagca gcaggcgctg       240
     ctgatggtcg atgaattcta tggcgagccg gggctttccg cgccgcgccg ggagtgcgag       300
     ttcgttccct tcaagccgtt ctgcgatgtg ctggtgctgg gcagcgccca ggcgcccggc       360
     gggcggccgg tacagcagtt gaccgcgggc atccgcgtcg gccgggtgag caaggcgctg       420
     gcggtgcatg ggccgcgcca gtgggaaccg ggattgctcg gtgccggcgc gggcgtcgcg       480
     cagccgttcc agcgccagga catttcctac gccagtgcct tcggcggcag ccatgcctcg       540
     ccggacaacc ctgatttcat ggattgctac atggccaatc cggccggatg tggctggttt       600
     ccgcgcagcg ccgacaccgc cgagatcgtc ggcacgccga tgccggccac ggaaaaactc       660
     ggcgagccgg tggacagccc ccacggccgc ttcacgccga tggcgctcgg cccgctcggt       720
     cgccactggc aggcccgggt cggctttgcc ggccgctacg acgacgcctg gctggccgag       780
     cgcttcccgt tcctgcccgc cgatttcgac gagcgttact tccagtccgc gccggccgac       840
     cagtggaccg accatctgcg cggcggcgag gaggtcctgc tgctcaacct caccggcgag       900
     gagcgcgcgg ccttccgcgt gccgcgcagg gaggtgccgg ttaccttctt cctgaaaaag       960
     ggtggccacg aaaccgcgca ggcacggatc gataccctgc tggtggactg cgacgcccgt      1020
     cgcgtggaag tcacctggcg cattcgccgg ccgttgaagc gcaacctgtt cgagatcgcc      1080
     caggtgctgg tcggcagcaa gtccgccgcc tggtggcgcg cccgcgagct gggcaaggac      1140
     tactacccct cgcttgccgc gttggcacgc agccgccagg ccgaggagga cgaggcatga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page