(data stored in ACNUC7421 zone)

EMBL: CP000438.PE101

CP000438.PE101       Location/Qualifiers
FT   CDS_pept        117109..118146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01190"
FT                   /product="Putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15055"
FT                   /db_xref="GOA:A0A0H2ZJS8"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS8"
FT                   /protein_id="ABJ15055.1"
FT                   /translation="MSQALSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGGE
FT                   WLLAASVPLEQPWRGRAKLLKMAARAIDEALRGQPDLDCTELPLLLCVAEGDRPGRCAG
FT                   LDESFLRDLEGELGRRFHPSSALIARGRVGGAVALLNARKLIQGGCRQVLVAGVDSFVS
FT                   GPTLAAYEARERLLTSQNSNGFIPGEGAAAVLVAAPLHEEAPQLLCIGLGFGIEKATVE
FT                   SEDLPLRADGLTQAVRAALAEAGCGLEQMDYRLTDISGEQYYFKEASLTLSRNLRVLKP
FT                   KFDLWHPADCIGECGAAIGPALLAVALAASCKGYGDGPNVFCHLGNDAGERAAALLSYR
FT                   RVRAA"
     atgagccagg ccctgagcat cgtcgcctcc ggcatggtca gcgcggtcgg cctcagcgcg        60
     ccggccagct gcgcggcgat ccgctgcgcc ctggacaact tccaggaaac ccgtttcatc       120
     gaccagggcg gcgaatggtt gcttgccgcc agcgtgccgc tggagcagcc ctggcgcggc       180
     cgcgccaagc tgctgaagat ggctgcgcga gccatcgacg aggccttgcg cggccagccc       240
     gatctcgatt gcacggagct gccgctgctg ctctgcgtcg ccgagggcga ccgtcccgga       300
     cgctgcgcgg ggctcgacga gtctttcctg cgtgacctgg aaggcgagct gggacgacgc       360
     ttccatccct cctcggcact catcgcccgt ggccgggtcg gtggcgcggt ggccctgctc       420
     aacgcgcgca agctgatcca gggcggctgc cggcaggtcc tggtggccgg cgtcgactcc       480
     ttcgtcagcg gcccgaccct ggccgcctac gaggcccgcg agcggctgct gaccagccag       540
     aactccaacg gcttcattcc cggcgagggc gccgccgccg tgctggtcgc cgcgccgctc       600
     cacgaggagg cgccgcagct gctctgcatc ggcctcggct tcggcatcga gaaggccacg       660
     gtggagagcg aggacctgcc gttgcgcgcc gacggcctga cccaggccgt gcgcgccgcc       720
     ctcgccgagg ctggctgcgg cctggagcag atggactacc ggctcaccga catttccggc       780
     gagcagtact acttcaagga ggcctcgctg accctgagtc gcaacctgcg cgtgctcaag       840
     ccgaagttcg acctctggca ccccgccgac tgcatcggcg aatgcggcgc cgccatcggt       900
     ccggcgttgc tcgccgtggc cctggccgct tcgtgcaagg gctacggcga cgggccgaac       960
     gtgttctgcc acctgggcaa cgatgccggc gaacgcgccg ccgcgctgct cagctatcga      1020
     cgggtgaggg ctgcctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page