(data stored in ACNUC7421 zone)

EMBL: CP000438.PE102

CP000438.PE102       Location/Qualifiers
FT   CDS_pept        118146..119237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15056"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR028917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ41"
FT                   /protein_id="ABJ15056.1"
FT                   /translation="MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIP
FT                   YPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYF
FT                   TSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPPWIYSDKQTMALHKDCEEDVQKEKTA
FT                   CAGKKTKAEKCADDGCKKARKCLLVSYNQGKRKSGIGCCPGEQPHHLIEAHCFYEVGKR
FT                   GEGDSMFFNAPAGKQPYKDTESPCVCAEGPRHAGEHGQYHAFQQALEAKHHEKSGGWTY
FT                   ADARNAGVKANKAVNEQCNDKCTAAQLDSYHKERCGVTDSTPLRTDPQAGTRSVGTLDA
FT                   KQTAALQAEIGAMSGMSAAGGSL"
     atggccaacg aggtgtacgc caacaacatg gagatctcct gcaaggcggc gagcggcaag        60
     tccatcgcgg ccttcccgga tgtctgcttc accccgccgc aggcgccgcc gacgccgttg       120
     ggggtaccga tcccctaccc caataccggc ctgtccaagg acaccaccaa aggcacccgg       180
     accattcgca tcacccgcaa ggaggtgatg ctgaagaaca agagctacta caagaccagc       240
     tacggcgacg agccggggcg ggcgccgaag aagggcatcg tcaccagcaa aatcaagggc       300
     aaggtgtact tcacctcctg gtcgatgaac gtcaagttcg aaagcaagaa cgtggttcgc       360
     cacctcgacc tgaccaccca caaccacgcg tcctttcccg gcaatacgcc accctggatc       420
     tattccgaca aacagaccat ggcgctgcac aaggattgcg aggaggacgt gcagaaggag       480
     aagacggctt gcgccggcaa gaagaccaag gcggagaagt gcgccgacga tggctgcaag       540
     aaagccagga aatgcctgtt ggtttcctac aaccagggca agagaaagag cggcatcggc       600
     tgctgtcccg gcgaacagcc gcaccacctg atcgaggcgc attgcttcta cgaggtgggc       660
     aagcgcggcg agggcgacag catgttcttc aacgcgcctg cgggcaagca gccgtacaag       720
     gacaccgagt cgccctgcgt gtgcgccgaa gggccccggc atgcgggcga acacggccag       780
     taccatgcct tccagcaggc tctggaggcc aagcaccacg agaagtccgg cggctggacc       840
     tacgcggatg cgcgcaacgc cggggtcaag gcgaacaagg cggtgaacga acagtgcaac       900
     gacaagtgca ccgcggctca gttggacagt tatcacaagg aacgctgtgg ggtgaccgac       960
     agcacgccgc tcaggaccga cccgcaggcg gggacacgct cggtgggtac gctggacgcc      1020
     aagcaaaccg ctgccctgca ggcggaaatc ggggcgatga gcggcatgtc ggcggccggc      1080
     ggttcactgt aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page