(data stored in ACNUC7421 zone)

EMBL: CP000438.PE104

CP000438.PE104       Location/Qualifiers
FT   CDS_pept        120178..121410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15058"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK43"
FT                   /protein_id="ABJ15058.1"
FT                   /translation="MLTSVVLDQHAEEAAFLALLRDYAVRAPHYDLEELAELDQRIEAH
FT                   LDGLAIAGQAGHDALLEQLDAHAQGEAFALAVLAMQAGDDALIGRMRACLAASPEARRG
FT                   FAAALGWLDWGQARPWVERLLASPEPLFRAIGLAACGMHRHDPGPALLSALGHADPAVL
FT                   ARAARTAGELRRRDLMANIRAYRAHDDPSLRFWANWATAQMGDEEALGPLRAFAGQPGP
FT                   FQLPATMVLLAWQPRDTSMAWIRQLMQAADTRRIGIQATGLFGDPVAVPWLIQQMRDES
FT                   LARVAGEAFSLITGADLALLDLELEALPDYDPGPNDDPDDDNVALDDDENLTWPEAERV
FT                   SAWWRDNGARFVAGRAYLLGEPLGEARCRQVLRNGQQRQRMAAACLLARFVPNLPLFPT
FT                   GAPVRRQLDLF"
     atgctgactt ccgtggtgct cgaccagcac gccgaggaag ccgccttcct tgccctgctc        60
     cgcgactacg ccgtgcgtgc gccccattac gacctggagg agctcgccga gctcgatcag       120
     cgcatcgagg cgcacctgga cggcctggcg atcgccggcc aggccggcca tgacgccctg       180
     ctcgagcaac tcgacgcgca cgcccagggc gaggcgttcg ccctcgcggt gctggccatg       240
     caggcaggag acgatgcgtt gatcggacgg atgcgcgcct gtcttgcggc gtctccggaa       300
     gcccggcgcg gtttcgccgc agccctcggc tggctcgact ggggccaggc gcggccctgg       360
     gtggagcgcc tgctggcctc gcccgagccg ctgttccgcg ccattggcct ggccgcctgc       420
     ggcatgcacc ggcatgaccc ggggccggcg ctgctgtccg cccttggcca cgccgacccg       480
     gcggtgctgg cgcgcgccgc gcgcaccgcc ggcgaactgc gtcggcgcga cctgatggcg       540
     aatatccgcg cctaccgcgc ccacgacgac ccgagcctgc gcttctgggc caactgggcc       600
     accgcgcaga tgggcgacga ggaggcgtta gggccattgc gtgcgttcgc cgggcagccc       660
     ggcccgttcc agctgccggc gaccatggtg ctgctcgcct ggcagccgcg tgacaccagc       720
     atggcctgga ttcgccaact gatgcaggcg gcggacacgc ggcggatcgg catccaggcc       780
     accggcctgt tcggcgatcc ggtggcggtg ccctggctga tccagcagat gcgcgacgag       840
     agtctggcgc gggtcgccgg cgaggccttc agcctgatca ccggcgccga cctggcgttg       900
     ctcgacctgg agctggaggc cttgcccgac tacgacccag gccccaacga cgatcccgac       960
     gacgacaacg tcgccctcga cgacgacgag aaccttacct ggccggaggc ggagcgagtc      1020
     tccgcctggt ggcgtgacaa cggcgcgcgc ttcgtcgccg ggcgcgccta cctgctcggc      1080
     gaacctctgg gcgaggcgcg ctgccgccag gtcctgcgca acggccagca acgccagcga      1140
     atggctgcgg cgtgcctgct ggcgcgcttc gtgccgaacc tgccgctgtt ccccaccggt      1200
     gcgccggtgc gccgccaact ggacctgttc tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page