(data stored in ACNUC7421 zone)

EMBL: CP000438.PE107

CP000438.PE107       Location/Qualifiers
FT   CDS_pept        124433..125029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ46"
FT                   /protein_id="ABJ15061.1"
FT                   /translation="MVDGFVQPVGEGLADQLVGHQVGHGGVQWDQRLAEVGDVAVVHFF
FT                   HQAVRQVGLIEQGVEAVVAGEQRRRGEEELLGDLQHRLDPFLDAGFAGHAVGGVEQVRY
FT                   LFDVGVDEAGEYVFRVLALRLDGAMQAGQAAGYQISQVTVAGFAEVRLLDEFTEGSGVH
FT                   GFSHTTGMVKKRRNIAGGARRLRRDCHNRFVVMRG"
     atggtggacg gcttcgtcca gccggttggc gaagggctcg ccgatcaact ggtgggccac        60
     caggttggcc acggtggtgt ccagtgggat cagcgcctgg ccgaagtggg cgatgtagcg       120
     gtcgttcact tcttccacca ggcggtgcgc caggtaggcc tcatcgagca gggcgtcgag       180
     gccgtcgtgg ccggcgagca acgccggcgg ggtgaggaag aactgctcgg cgaccttcag       240
     caccggcttg atccgttcct cgatgccggc ttcgcgggcc acgctgttgg cggcgtcgag       300
     caggtccggt acctgttcga cgtaggcgtg gacgaagcgg gtgagtatgt cttccgtgtt       360
     ctcgccttgc ggctggatgg tgcgatgcag gcggggcagg cagctggcta tcagatcagc       420
     caggtgaccg tggcgggctt cgctgaggtg cgcctgctgg atgagttcac ggagggcagc       480
     ggtgttcatg ggttctccca tacaacgggg atggtgaaga agaggagaaa catagccggc       540
     ggcgcgcgcc ggctaagacg cgattgtcat aatcgcttcg tggttatgcg aggatga          597
//

If you have problems or comments...

PBIL Back to PBIL home page