(data stored in ACNUC7421 zone)

EMBL: CP000438.PE113

CP000438.PE113       Location/Qualifiers
FT   CDS_pept        129723..130517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15067"
FT                   /db_xref="GOA:A0A0H2ZK45"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK45"
FT                   /protein_id="ABJ15067.1"
FT                   /translation="MGGFMQYSQRLGEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLLW
FT                   LGTWQLQRADEKRALLASYEARRGAEPVSPGQLEGLRDPAYVRVRLHGRFDERHTLLLD
FT                   NRLRNGQAGVEVLQPFYDQASGLWLLVNRGWVAWTDRRSPPTLETPDRVLLLDAWTYLP
FT                   PPGGLHLADAPAGGWPRLVTQLDIPALWQAFGRAGLPWEIRLEPGDASFDTDWPLVSMP
FT                   PERHTGYAVQWFALATALLALYLYLGVRRAREKNHESRDSDA"
     atggggggat tcatgcagta tagccagcgc ctcggggagg ccggacgcaa tgacagacgc        60
     agcatgcgtg gcgcgttccg ccccggcctg ctgccgaccc tggtagtcct cggcctgctg       120
     ccggtgctgc tctggctggg cacctggcag ttgcagcggg ccgacgagaa gcgcgccctg       180
     ctggccagct acgaggcccg gcgcggcgcc gagccggtgt cgcccgggca gctagagggg       240
     ctgcgcgacc cggcgtacgt ccgcgtgcgc ctgcacggcc gcttcgacga gcggcatacg       300
     ctgctgctgg ataaccggct gcgcaacggg caggccgggg tcgaggtgct gcaacccttc       360
     tacgaccagg ccagcggcct ctggctgctg gtcaaccgcg gctgggtcgc atggactgac       420
     cgacgttcgc cgccgacgct ggaaaccccc gaccgcgtcc tcctgctcga cgcctggacc       480
     tacctgccgc cacccggcgg cctgcacctg gccgacgcgc cggccggcgg ctggccgcgc       540
     ctggtgaccc agctcgacat cccggcgctg tggcaggcct tcggtcgcgc cgggctgccc       600
     tgggaaatcc gcctggaacc gggcgacgcc agcttcgaca ccgactggcc cctggtctcg       660
     atgccgccgg agcggcacac cggctacgcc gtgcagtggt tcgccctggc gacggccctg       720
     ctcgccctct atctctacct cggtgtgcgc cgcgcacggg agaaaaacca tgagtctcgc       780
     gattccgatg cctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page