(data stored in ACNUC7421 zone)

EMBL: CP000438.PE114

CP000438.PE114       Location/Qualifiers
FT   CDS_pept        130492..131070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15068"
FT                   /db_xref="GOA:A0A0H2ZK48"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK48"
FT                   /protein_id="ABJ15068.1"
FT                   /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWVP
FT                   QGRSYSGALIGNGQTPADLGVQGRSQGEQWQLLVTAPGTCGEDCQQLVYLARQVNIALG
FT                   REASRAGHALAASGELPADFANLVRQDYPRLQRYGLDPALYDKAGGGERPLLWVVDPHG
FT                   NLVLRYDAKANGKKLLKDVQLLLKLSHIG"
     atgagtctcg cgattccgat gcctgaacgt ccgcgccgcg cccgcggccg cctgcaactg        60
     ctggcgatca tcggcctggt ggtggggccg atgctgctcg ccagcgccat gtacaaatgg       120
     aatttctggg tgccacaggg gcgcagctac agcggcgcgc tgatcggcaa cggccagacc       180
     cccgccgacc tcggcgtgca gggacgcagc cagggcgagc agtggcaact gctggtgacc       240
     gcgccgggca cttgcggcga ggactgccag caactggtct acctggcccg ccaggtcaac       300
     atcgccctcg gccgcgaagc ctcgcgcgcc ggccacgccc tggccgccag cggcgagctg       360
     ccggcggact tcgccaacct ggtgaggcag gactacccgc gcctgcagcg ctacggcctg       420
     gacccggccc tgtacgacaa ggccggcggc ggcgagcggc cgctgctgtg ggtggtcgac       480
     ccgcacggca acctggtgct gcgctacgac gccaaggcca acggcaagaa gctgctgaag       540
     gacgtgcaac tgctgctcaa gctctcgcat atcggttga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page