(data stored in ACNUC7421 zone)

EMBL: CP000438.PE117

CP000438.PE117       Location/Qualifiers
FT   CDS_pept        133174..133809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01390"
FT                   /product="putative Sco1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15071"
FT                   /db_xref="GOA:A0A0H2ZJU0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU0"
FT                   /protein_id="ABJ15071.1"
FT                   /translation="MTRVNKTVLVLVALVALVLGLTVHKVLTAQRQADPTVLLDAGIVI
FT                   LPQTRKVPALEFTNQDGQAVSTASLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKLPQ
FT                   EVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANAMSIPYIPAD
FT                   TSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
     atgactcgag tcaacaagac cgtcctcgtc ctcgtcgccc tggtcgccct ggtcctcggc        60
     ctcaccgtgc acaaggtgct caccgcccag cgccaggccg atcccaccgt gctgctcgac       120
     gccggcatcg tgatcctgcc gcagacgcgc aaggtgccgg cgctggagtt caccaaccag       180
     gacggccagg cggtcagcac cgccagtctc aagggtcgct ggcacctgct gttcttcggc       240
     tacaccttct gccccgatgt ctgcccgacc accctcgccc agctccgcga attgcagggc       300
     aagctgccgc aggaggtgcg cgacgacctg caggtggtat tcgtcagcgt cgatccgaac       360
     cgcgacacgc cgcagcagat caagcaatac ctgggctact tcaacgccgg cttccagggg       420
     ctcaccggta ctccggagaa catccagaag ctggccaacg ccatgagcat cccctacatc       480
     cccgccgaca ccagcaagcc caactacacc gtcgaccaca gcggcaacct ggtgatcatc       540
     ggtccggacg gcgagcagca cggcttcatc cgcgcgccgc tgaacaacgc caagctggaa       600
     gcccaactgc ccggcgtgct caagccgcag gcctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page