(data stored in ACNUC7421 zone)

EMBL: CP000438.PE12

CP000438.PE12        Location/Qualifiers
FT   CDS_pept        15208..15474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14968"
FT                   /db_xref="GOA:A0A0H2ZJX8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX8"
FT                   /protein_id="ABJ14968.1"
FT                   /translation="MDNQRQYPRTPLKCRIRISHPLFGELMAQTRDLSDTGVYVKHPDL
FT                   TQLPTGSVVTGQVQDLPIDAPILQMEVVRVDAEGVGLRFLSEA"
     atggataatc aacgacaata cccacgaacc ccgctcaagt gccgaatccg tatcagtcac        60
     ccgttatttg gcgagctgat ggcgcagaca cgcgacctct ccgacaccgg ggtctatgtc       120
     aaacacccgg atctgaccca gctcccaaca ggcagtgtcg ttactggcca ggtacaggat       180
     ctgccgatcg acgcgccgat cctgcagatg gaagtcgtgc gagtcgatgc ggaaggcgtc       240
     ggcctgcgct ttctcagcga agcctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page