(data stored in ACNUC7421 zone)

EMBL: CP000438.PE127

CP000438.PE127       Location/Qualifiers
FT   CDS_pept        complement(141481..141762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01510"
FT                   /product="putative plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15081"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD2"
FT                   /protein_id="ABJ15081.1"
FT                   /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQ
FT                   VANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKEIQILRIDRVEITP"
     atgagcctga agtggacccg caaggcggcc gccgacctgg acgccatcta cgaccattac        60
     gtcgtgctga tcggcccgga aaaagccctg aaagccgtcc aggacatcgt cgagcaggtg       120
     aaaccgctgc agcaggtagc caaccagggg gcagggcggc ccagcgaggt gccaggcgta       180
     cgcaccctga ccctggagcg ctggccgttc agcgcccctt ttcgggtaaa aggcaaggaa       240
     atccagattt tgcgcatcga cagggtcgaa attaccccct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page