(data stored in ACNUC7421 zone)

EMBL: CP000438.PE129

CP000438.PE129       Location/Qualifiers
FT   CDS_pept        complement(142162..142785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ69"
FT                   /protein_id="ABJ15083.1"
FT                   /translation="MPTRVLRGLVAALPLLFLAACSDSAPSSEEIARLLAERGFDKPAC
FT                   ASSTLFKTFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLRRDGDSYDLTPAGREDYKSE
FT                   SKAFCYSSGFDVSVRSVDPAKPDDYGPAVEKGWLVTVEVKPREVKDWAKNPEVLKQASL
FT                   TTLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
     atgcctacac gcgttctgcg cggcctcgtc gccgccctcc cactgttgtt cctcgccgcc        60
     tgctcggact ccgctccgtc cagcgaggag atcgcccgcc tgctcgccga gcgcggcttc       120
     gacaaacccg cctgcgccag ctccaccctg ttcaagacct tcccggtgac gctctccgac       180
     agcttctccg gccccggccc ggcgaaaggc aacgccgcgg tctacgacgc gctggtcggc       240
     gtcggcctgc tgcgccgcga cggcgattcc tacgacctca cgcccgccgg ccgcgaggac       300
     tacaagtccg agtcgaaggc cttctgctac agcagcggct tcgacgtcag cgtccgttcg       360
     gtggaccccg ccaagcccga cgactacggc ccggccgtgg aaaagggctg gttggtcacc       420
     gtcgaggtca agccacgcga agtgaaggac tgggcgaaga accccgaggt gctcaagcag       480
     gccagcctga ccaccctgca acagatcacc caaccgcagg tcggccaggt ctcgctggtc       540
     aagccacgcg gcgaggaagg ctacaagctc gtcaacaccc gcttctcgcc caggcagggc       600
     ttccacttca accaggcctg gtaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page