(data stored in ACNUC7421 zone)

EMBL: CP000438.PE13

CP000438.PE13        Location/Qualifiers
FT   CDS_pept        15621..16274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00140"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14969"
FT                   /db_xref="GOA:A0A0H2ZK11"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK11"
FT                   /protein_id="ABJ14969.1"
FT                   /translation="MSASSPAAWRGTLAGLIAFHIVIIIASNYLVQLPITLFGWHTTWG
FT                   AFSFPFIFLATDLTVRLLGKGPARLVIARVMIPALIASYVVSVLFQEAAFRGFSALLEF
FT                   NTFVARISLASFLAYVLGQILDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFFVAF
FT                   WRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPQSNA"
     atgtcagcct cttctccggc ggcctggcgc ggcaccctgg ccggcctgat cgccttccac        60
     atcgtcatca tcatcgccag caactacctg gtgcagttgc cgatcaccct gtttggctgg       120
     cacaccacct ggggcgcctt cagctttccg ttcatcttcc tggctaccga cctcaccgtg       180
     cgcttgctgg gcaagggccc tgcccggctg gtcatcgccc gggtcatgat cccggcgttg       240
     atcgcctcct acgtggtctc ggtgttgttc caggaagcgg cgttccgtgg tttctccgcg       300
     ctgctcgagt tcaacacctt cgtcgcacgg atctccctgg caagcttcct cgcctatgtg       360
     ctcgggcaga tcctcgacat ccaggtattc gaccgcctcc gtcgttcccg gcactggtgg       420
     accgcgccag tcgcctcgac catcctcggc aacctgctgg acaccttcac cttcttcttc       480
     gtggcgttct ggcgcagcga caatccgttc atggcgcagc actgggtgga aatcgccacg       540
     gtggactacg gagtgaagct gagcatcagc cttctgctgt tcgtgccgct ctacggcatg       600
     ctactcaacg gcatcctgaa gatgctgccg gggcggccgc agagcaacgc ttga             654
//

If you have problems or comments...

PBIL Back to PBIL home page