(data stored in ACNUC7421 zone)

EMBL: CP000438.PE143

CP000438.PE143       Location/Qualifiers
FT   CDS_pept        complement(158517..159413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15097"
FT                   /db_xref="GOA:A0A0H2ZKF2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF2"
FT                   /protein_id="ABJ15097.1"
FT                   /translation="MALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQI
FT                   ELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQ
FT                   WYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLSNSG
FT                   ILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDT
FT                   ADAPWTVIKSDDKKRARLNCIRHFLHALDYPDKDRRIAHEPDPLLVGPASRVIEEDEKV
FT                   YAEAAAAPGHANLDIPA"
     gtggccctgc aggtcgccag cgcgccccac ggcagcagcg aggacagcac ctcggcgagc        60
     ctgccggcga actatcctta tcacacgcgg atgcgccgca acgagtacga gaaagccaag       120
     cacgacctgc agatcgaact gctcaaggtg cagagctggg tgaaggagac cggccagcgc       180
     gtggtggtcc tgttcgaagg ccgcgacgcc gccggcaagg gcggtaccat caagcgcttc       240
     atggagcacc tgaacccgcg cggcgcgcgg atcgtagccc tggagaaacc ctcctcccag       300
     gagcagggcc agtggtattt ccagcgctac atccagcacc tgcccaccgc cggcgagatg       360
     gtcttcttcg accgctcctg gtacaaccgc gccggcgtcg agcgggtcat gggcttctgt       420
     tcgccactgc aatacctgga gttcatgcgc caggcccccg agctggagcg catgctgagc       480
     aacagcggca tcctgctgtt caagtactgg ttctcggtga gccgcgagga gcaactgcgg       540
     cgcttcatct cgcgccgcga cgatccgctc aagcactgga agctgtcgcc catcgacatc       600
     aagtctctgg acaagtggga cgactacacc gccgccaagc aggcgatgtt cttccatacc       660
     gacaccgccg acgcgccgtg gacggtcatc aagtccgacg acaagaagcg cgcacgactc       720
     aactgcatcc gccacttcct gcacgcgctg gactacccgg acaaggaccg gcgcatcgcc       780
     catgagcccg acccgttgct ggtggggccg gcctcgcggg tgatcgagga ggacgagaag       840
     gtctacgccg aggcggccgc cgcgccgggc cacgcgaacc tggatatccc ggcctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page