(data stored in ACNUC7421 zone)

EMBL: CP000438.PE146

CP000438.PE146       Location/Qualifiers
FT   CDS_pept        complement(162413..163261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01770"
FT                   /product="putative nucleoside-binding outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15100"
FT                   /db_xref="GOA:A0A0H2ZK78"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK78"
FT                   /protein_id="ABJ15100.1"
FT                   /translation="MRKALLCCAAPLCAAAAFGAENNDENAAREGLWNNLHVYRAFNQR
FT                   GGPYLTDDSYLEWEFGGRKGVLDLYGYIDYKNLFDDASSDVPDGENWFVDIEPRLSIDR
FT                   LLGRDFSIGPIREWFVAFDYYYADARQGPGLNVLWSGIGTNTELPWLGTVGLNLYARYI
FT                   DKNYGASNENAWDGYVAHMNWFKPLAQFGGKRFIAFQGFFDYEFGSKLPDKDDAFEREY
FT                   RTDNGFQAYLGLWYHTEHWKFGYGAKVYRNMTQWRDGEQLDGRRTDSSGIGHYFNVGYA
FT                   F"
     atgcgcaaag ccctgctgtg ctgtgccgcc ccgctgtgcg cggccgccgc cttcggcgcc        60
     gaaaacaacg acgagaacgc cgcccgcgaa gggctctgga acaacctgca cgtctaccgc       120
     gcgttcaacc agcgcggcgg cccctacctg accgacgaca gctacctgga atgggagttc       180
     ggcggccgca agggggtgct cgacctgtac ggctacatcg actacaagaa cctcttcgac       240
     gacgccagct cggacgtacc cgacggcgag aactggttcg tcgacatcga gccgcgtctc       300
     tccatcgacc gcctgctcgg ccgcgacttc tccatcggcc cgatccgcga atggttcgtc       360
     gccttcgact actactacgc cgacgcgcgc cagggaccgg ggctgaacgt gctgtggtcg       420
     ggcatcggca ccaacaccga gctgccctgg ctgggtacgg tggggctcaa tctctacgcg       480
     cgctacatcg acaagaacta cggcgcgtcc aacgagaacg cctgggacgg ctacgtcgcc       540
     cacatgaact ggttcaagcc gctggcgcag ttcggcggca agcgcttcat cgccttccag       600
     ggcttcttcg actacgagtt cggctcgaag ctgcccgaca aggacgatgc cttcgagcgc       660
     gaataccgta ccgataacgg cttccaggcc tacctcgggc tctggtatca caccgaacac       720
     tggaagttcg gctacggcgc caaggtctac cgcaacatga cccagtggcg cgacggcgag       780
     caactggacg gacgccgcac cgactccagc gggatcggcc actacttcaa cgtcggctac       840
     gcgttctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page