(data stored in ACNUC7421 zone)

EMBL: CP000438.PE149

CP000438.PE149       Location/Qualifiers
FT   CDS_pept        164828..165925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01800"
FT                   /product="putative basic membrane protein (bmp)"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15103"
FT                   /db_xref="GOA:A0A0H2ZJW7"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW7"
FT                   /protein_id="ABJ15103.1"
FT                   /translation="MKHRPTQSRMSVLRRLAVVLGLGACALAAEAAEPLKIGFVYVGPV
FT                   GDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTSFG
FT                   YMNPTAKVARQFPKVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKIGYI
FT                   ASFPIPEVIRDINAIQLALDKYDPQAELKVMWVSTWFDPGKEADAANALIDQGVDVVFQ
FT                   HTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMDGTWKS
FT                   EDFWGGLAESTVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSGKERFAA
FT                   GVSATNADLASMNYYVEGIKADLPK"
     atgaaacacc gtcccacgca atcccgcatg tccgtcctgc gccgccttgc cgtcgtcctc        60
     ggcctcggcg cctgcgctct cgccgccgag gccgccgaac cactgaagat cggcttcgtc       120
     tatgtcggcc cggtcggcga ccacggctgg acctaccagc acgagctggg ccgccgcgaa       180
     ctggtggagc acttcggcga caaggtgaag accagcttcg tcgagaacgt cgccgagggc       240
     gccgacgccg agcgggtcat ccgcaacctg gcgaaagacg gctacggcct ggtcttcacc       300
     acttccttcg gctacatgaa ccccaccgcc aaggtggccc gacagtttcc caaggtgacc       360
     ttcgagcacg ccaccggcta caagcgcgac aggaacctcg gcacctacct gtcgcgctcc       420
     tacgagggac gctacgtcgg cggcttcctc gcggcgaaga tgacccgcag ccacaagatc       480
     ggctacatcg cctcgtttcc gattcccgag gtgatccgcg acatcaacgc gatccagctg       540
     gcgctggaca aatacgaccc gcaggccgaa ctcaaggtga tgtgggtgag cacctggttc       600
     gatccgggca aggaggccga cgcggccaac gcgctgatcg accagggcgt cgacgtggtg       660
     ttccagcaca ccgatagccc ggcgccgatc caggccgccg agcgtcgcgg ggtgtacgcc       720
     gtgggctacg cctcggacat gcagcacttc ggtccgaaga ccgtgctcac ctcgatcgtc       780
     aacgactggg gcccgcacta tatccgctcg gcccaggcgg tgatggacgg cacctggaaa       840
     tccgaggact tctggggcgg cttggccgag agtacggtgg tcctgccgct gaaccaggag       900
     gtgctgccgg cgccggtgcg ggaagaggcg ggcaggctga tcgagtcgat ccgcagcgga       960
     gccttccacc ccttcaccgg gccgatccgc gaccagtccg gcaaggagcg tttcgccgcc      1020
     ggcgtcagcg cgaccaatgc cgacctggcg tcgatgaact attacgtgga aggcatcaag      1080
     gccgacctgc cgaagtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page