(data stored in ACNUC7421 zone)

EMBL: CP000438.PE15

CP000438.PE15        Location/Qualifiers
FT   CDS_pept        complement(16923..17240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00160"
FT                   /product="putative tetratricopeptide repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14971"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIW8"
FT                   /protein_id="ABJ14971.1"
FT                   /translation="MMIEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERATEHLQRCVE
FT                   QDPTYSAGWKLLGKARQAAGDLAGARQAWEQGLAAAATHGDKQAEKEMTVFLRKLDRAR
FT                   T"
     atgatgatcg aaggtctgga aaagatgctg gccaaaggcg tggacaatgc gctgctgcgc        60
     ttcggcctgg gcaagggcta cctggacgcg ggcgacgccg aacgcgcgac ggaacacctc       120
     cagcgttgcg tagagcagga cccgacgtat tccgctggct ggaaactgct gggcaaggcg       180
     cgccaggctg ccggcgatct cgcgggcgcc cggcaggcct gggagcaagg cctggcagct       240
     gccgcgacgc atggcgacaa gcaggccgaa aaggaaatga cggtgttcct gcgcaagctc       300
     gatagggcga gaacctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page