(data stored in ACNUC7421 zone)

EMBL: CP000438.PE154

CP000438.PE154       Location/Qualifiers
FT   CDS_pept        169897..172284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01870"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15108"
FT                   /db_xref="GOA:A0A0H2ZKG6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG6"
FT                   /protein_id="ABJ15108.1"
FT                   /translation="MTPFPRFALRTLPALFLSLGCLAATAQAAEAVRYRFSQAAAPLAQ
FT                   ALNAFSRASGQTLLYTAELPPQATAPALHGSLDAEEALQRLLQGSGLRARRIDERTLTL
FT                   EPIPASGALDLDATTVSAAAPAQGYRPAANASISRGDAPLLEIPQAISVVPAQALQDQR
FT                   PRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTATADH
FT                   VEVLKGPASLLYGIQDPGGVVNVVSKKPQLQQANALTLRGSAYAHGRNGSGGQLDSTGP
FT                   LGDSGLAYRMILDHEDEDYWRDFGKSRETLVTPSLAWYGEDTTVNLSYEHREFTTPFDR
FT                   GTAIDPRTNRPLDIPRSRRLDEPFNITEGRSELTRLDLERQLDDTWKAHFGYGYSRETY
FT                   DDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGTLQLAGMQHDLQFGMDHEKR
FT                   KIFRADLLRDSKTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYFQDSIHLDER
FT                   WILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSLYGSYTRSFKP
FT                   NSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRKKNVLVNELDGA
FT                   GNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLAAEVTEDPTLEGKRLQNVARNT
FT                   ASLSAVYELGQLFGGDRLRLGGGARYVGKRPGDPANSFDLPSYTVADAFASYDTRFGGH
FT                   GVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQLSTTVEF"
     atgaccccgt tcccgcgctt cgccctgcgt actctccccg ccctgttcct cagcctcggc        60
     tgtctcgccg ccaccgcgca ggccgccgag gcggttcgct atcgcttcag ccaggctgcc       120
     gcgccgctgg cccaggcgct caacgcgttc agccgggcca gcgggcagac gctgctctac       180
     accgccgagc tgccgccgca ggcgaccgcc ccggcattgc acggttcgct ggacgcggag       240
     gaggcgctgc aacgcctgct gcagggcagc ggcctgcgcg cgcggcggat cgacgagcgc       300
     accctgaccc tggaaccgat ccccgccagc ggcgcgctcg acctcgatgc cacgacggtg       360
     tccgccgccg ccccggcgca gggctaccgg ccggcggcca acgcctcgat cagccgcggc       420
     gatgcgccgc tactggaaat cccccaggcg atcagcgtgg tcccggcaca ggcgctgcag       480
     gaccagcgcc cgcgcaacct tgacgacgcg ctgggcaaca tcagcggcat cacccaggcc       540
     aacaccctcg gcggtaccca ggacgcggtg atgaaacgcg gcttcggcga caaccgcgac       600
     ggctcgatca tgcgcgacgg catgccctcg gtgcagggcc gcaatttcac cgccaccgcc       660
     gaccacgtcg aggtgctgaa ggggcctgca tccctgctct atggcatcca ggacccgggc       720
     ggggtggtca acgtggtgag caagaagccg caactgcaac aagccaacgc cctgaccctg       780
     cgtggctcgg cctacgccca cgggcgcaac ggcagcggcg gccagctcga ctccaccggc       840
     ccgctgggcg acagcggact ggcctaccgg atgatcctcg atcatgagga cgaggattac       900
     tggcgcgact tcggcaagag tcgcgagacg ctggtgacgc cctcgctggc ctggtacggc       960
     gaggacacga cggtcaacct gagctacgag caccgcgagt tcaccacgcc gttcgaccgt      1020
     ggcacggcca tcgacccgcg taccaaccgc ccgctggaca tcccgcgcag ccggcgcctg      1080
     gacgagccct tcaacatcac cgagggccgt tccgagctga cccgcctgga tctcgaacgg      1140
     cagctcgacg acacctggaa ggcccacttc ggctacggct acagtcgcga gacctacgac      1200
     gacaaccagg cccgggtgat ggccgtgaat gccgacggca ccctgacccg gcgcatggac      1260
     ggcacccacg gcgcggtcag cagcgacagc ttcgccaccc tcggcctgag cggaacgctg      1320
     caactggccg ggatgcaaca tgacctgcaa ttcggcatgg accacgagaa gcgcaagatc      1380
     ttccgcgccg acctgctgcg cgacagcaag accagccgct tcgactacct cgacccggtc      1440
     tatggccagg tggtgccgtc gacccgggtg gtcgccggcg acagcgacca gaccgacaag      1500
     ctgcgcagcg actcgctgta cttccaggac tcgatccacc tggacgaacg ctggatcctg      1560
     gtcggcggcg cgcgctacca gatctacgac cagctcgccg ggcgcggccg gccgttcaac      1620
     gccaacaccg acatcaacgg gcagaaatgg gtgccgcgcg gcggcctggt ctaccgcctg      1680
     agcgacgagg tttcgctgta cggcagctac acgcgctcgt tcaagccgaa ctcgaccatc      1740
     gccccgctga gcaccggcga gaccatcgat tcggcgatcc tgccggagga ggcgacctcc      1800
     tgggagctgg gcgccaagct ggatgtgccg gggcgtctca gcggcaccct ggcgctgttc      1860
     gacatccgca agaagaacgt gctggtcaac gaactcgacg gtgccggcaa cagcagcgtg      1920
     cgcgccgccg gccgggtccg ctcgcgcggc ctggagctgg acctcaccgg ccagctcagc      1980
     gaacgctgga gcctgatcgg cagctacgcc tggctcgccg cggaagtcac cgaggacccg      2040
     accctggagg gcaagcgcct gcagaacgtg gcgcgcaaca ccgcgtcgct gtcggcggtc      2100
     tacgaactcg gccagctctt cggcggcgac cgcctgcgcc tgggcggcgg cgcgcgctac      2160
     gtcggcaagc gcccgggcga cccggccaat tccttcgacc tgccgtccta caccgtggcc      2220
     gatgccttcg ccagctacga cacccgcttc ggcggacacg gcgtgaagtt ccagctcaac      2280
     gtgaagaacc tgttcgaccg cacctactac ccgtccagtg ccaatcgcct gtacgtggcg      2340
     atgggcgagc ctcggcagtt ccagctgtcg acgacggtgg agttctga                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page