(data stored in ACNUC7421 zone)

EMBL: CP000438.PE160

CP000438.PE160       Location/Qualifiers
FT   CDS_pept        177315..178385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01960"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15114"
FT                   /db_xref="GOA:A0A0H2ZJX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX6"
FT                   /protein_id="ABJ15114.1"
FT                   /translation="MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDLG
FT                   RFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLA
FT                   SAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLS
FT                   YTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFL
FT                   VSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVR
FT                   SVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGV
FT                   NSLKPGQKIKLDEDAR"
     atgaagccgt tttccctcgc cggcctgttc ggcttcgccc tgctcctctc cggctgcggc        60
     gacgagccgc cgccggcacc gccgcggccg gtgctgacgg tgaccgtgaa gaccctgaag       120
     aacgacgacc tcggtcgctt cgccgggagc atccaggcgc gctacgagag cgtgctcggc       180
     ttccgcacca acggacggat cgcctcgcgc ctgttcgacg tcggtgactt cgtcggcaag       240
     ggcgcgctgc tggcaaccct cgaccccacc gaccagcaga accagttgcg cgccagccag       300
     ggcgacctgg ccagcgccga ggcgcagttg atcgacgccc aggccaatgc ccggcgccag       360
     gaagaactgt tcgcccgcag cgtcaccgcc caggcgcgcc tggacgatgc gcggacccgc       420
     ctgaagacca gccaggccag cttcgaccag gccaaagcgg cggtgcagca ggccagggac       480
     cagctttcct acacgcgcct ggtgaccgat ttcgacggcg tcatcaccac ctggcacgcc       540
     gaggccgggc aagtggtcag cgccggccag gcggtggtca ccctggcccg gcccgaggtg       600
     cgcgaggcgg tcttcgacct gcccaccgag gtcgccgaga gcctgccggc cgacgcgcgc       660
     ttcctggtca gcgcccagct cgacccgcag gccaggacca ccggcagcat ccgcgagctg       720
     ggtccgcagg ccgacgcctc gacccgcacc cgtcgcgtgc gcctgagcct ggcgcagacg       780
     ccggaggcgt tccgcctcgg ctcgaccatc caggtccagc tgagcagcgc cggtagcgtg       840
     cgcagtgtgc tgccggccag cgtgctgctg gagcgggacg gcaagaccca ggtctgggtc       900
     gtcgatggga aacagtccag cgtggccctg cgcgaggtac aggtgctcag ccgcgacgaa       960
     cgccaggtgg tgatcggaca gggcctggcc gacggcgacc gggtggtccg cgccggagtc      1020
     aacagcctca agcccggcca gaagatcaaa ctcgacgagg atgcgcgatg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page