(data stored in ACNUC7421 zone)

EMBL: CP000438.PE164

CP000438.PE164       Location/Qualifiers
FT   CDS_pept        183147..183299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH6"
FT                   /protein_id="ABJ15118.1"
FT                   /translation="MESLKPDESKRLSIEESDCVPTGFQCPEIHWQDFPTPNFDCSYST
FT                   SSQGR"
     gtggaaagcc taaagcccga tgagtcgaag agactttcaa tagaagagtc cgactgtgtt        60
     ccaaccggtt tccagtgtcc ggaaatacac tggcaagact tcccgacgcc gaactttgat       120
     tgctcctatt cgacgtcttc tcaaggccgc tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page