(data stored in ACNUC7421 zone)

EMBL: CP000438.PE168

CP000438.PE168       Location/Qualifiers
FT   CDS_pept        187980..188816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02060"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15122"
FT                   /db_xref="GOA:A0A0H2ZK89"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK89"
FT                   /protein_id="ABJ15122.1"
FT                   /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESL
FT                   TYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEITP
FT                   RLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNFYYR
FT                   KPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLH
FT                   FNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF"
     atgagccgca cactcgccac cgtgatgcta gccggggggc tgctggccgc aggccaggct        60
     gtcgccgaag accatgacat gacgccgacc cacgagaccg actcggggcc gctgctctgg       120
     cacaacgaga gcctgaccta cctctacggc aagaacttca agatcaaccc gccgatccag       180
     cagaccttca ccctggaaca tgccagcggc tggacctggg gcgacctgtt catcttcttc       240
     gaccagatca actacaacgg caaggaagac gccagcaacg gcaagaacac ctactacggc       300
     gagatcactc cgcgcctgag cttcggcaag ctcaccggag cggacctctc cttcggcccg       360
     gtgaaggacg tgctgctggc cggcacttac gagttcggcg aaggcgacac cgaggcctac       420
     ctgctcggcc cgggcttcga cctggcgatc cccggcttcg actacttcca gctcaacttc       480
     tactaccgca agcccgacgg caaccgcgtg cgcgccggcg cctggcagat caccccggtg       540
     tggtcctaca ccattccggt gggcaactcc gacatcctca tcgacggcta catggactgg       600
     gtgatcaaca acaagagcgc cagcaccagc cgccgcaacc agagcgacta ccacgccaac       660
     ctgcacttca acccacaggt caagtacgac ctgggcaagg ccctcggcta cgagcctaag       720
     cacctgtacg tgggcctgga gtacgactac tggtccgaca agtacggtgt gaaggactcg       780
     cagtacttca ccaccgacca gaacaccgcc agcttcctgg tcaagtacca cttctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page