(data stored in ACNUC7421 zone)

EMBL: CP000438.PE171

CP000438.PE171       Location/Qualifiers
FT   CDS_pept        191228..191818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15125"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJA5"
FT                   /protein_id="ABJ15125.1"
FT                   /translation="MPSTLQGLAEYREEIRKSRFHTIAAPVADEDEAQAFIAAHRDASA
FT                   GHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVVVLVSRWFGGIKLGTGGL
FT                   ARAYGGGAAKCLQQAPRSELVERCRVRFACAFADHALLKARSLALGASVAAEDYGADGV
FT                   VLTLELPVARFEALQALLVDLSRGQVRPQRLDA"
     atgccgagca ccctgcaagg cctcgccgaa taccgcgagg aaatccgcaa gagccgcttc        60
     cacaccatcg ccgcgccggt ggccgacgag gacgaggcgc aggcgttcat cgccgcccac       120
     cgcgacgctt ccgccggaca caactgctgg gcctggaagt gcggcgcgca gtaccgcttc       180
     agcgacgacg gcgaacccgg cggcagcgcc gggcggccga tcctggcggc catcgaggga       240
     caggacatgg actgcgtggt ggtgctggtc agccgctggt tcggtggcat caagctcggc       300
     accggcggcc tcgcccgcgc ctatggcggc ggcgcggcca agtgcctgca gcaggcgccg       360
     cgcagcgagc tggtcgagcg ctgccgggtg cgcttcgcct gtgccttcgc cgaccacgcg       420
     ctgctcaagg cgcgcagcct ggcgctgggc gccagcgtgg cggcggaaga ctacggcgcc       480
     gacggcgtcg tcctgaccct ggagttgccg gtggcgcgct tcgaggcgct tcaggcgctg       540
     ctggtggacc tcagccgagg ccaggtgcgg ccgcagcggc tggacgcctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page