(data stored in ACNUC7421 zone)

EMBL: CP000438.PE172

CP000438.PE172       Location/Qualifiers
FT   CDS_pept        complement(191825..192532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02110"
FT                   /product="putative GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15126"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA5"
FT                   /protein_id="ABJ15126.1"
FT                   /translation="MRLERIARISDGFQSMAREQNLSLSERYHKQLRRLEKVARISDRY
FT                   QQMMRDLNLALKEASIRDPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQ
FT                   VNDTWGHDSGDRVLVEIARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVR
FT                   DSVRTLAVRVGTEALSVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAL
FT                   PPLPAPSRPAPAR"
     gtgcggctgg agcgcatcgc ccggatctcc gacggtttcc agtcgatggc gcgggagcag        60
     aacctgtcgc tgtccgagcg ctaccacaag caactgcggc gcctggaaaa ggtggcgcgg       120
     atctccgacc gctaccagca gatgatgcgc gacctcaacc tggcgctgaa ggaagcctcg       180
     atccgcgacc cgctgaccgg cctgcccaac cgacgcatgc tgctggagcg cctcagggag       240
     gagaacgaac gctcccagcg ccacggccag agctacgtgc tggcgatgct cgacgtggac       300
     ttcttcaagc aagtcaacga tacctggggc cacgacagcg gcgaccgggt gctggtggaa       360
     atcgcccggg ccatggagtc cgagctgcgc gaatacgacc tctgcggccg ctggggcggc       420
     gaggaattcc tcctgctgct gccgcagacc cgcctgcagg acgccggccc ggtactcgag       480
     cgggtgcgcg acagcgtacg gaccctggcg gtacgcgtcg gcaccgaggc gctgagcgtc       540
     accgccagcg tcggcgtcac cgaacaccgc atcggcgaaa cctattcgca gaccgtcaat       600
     cgcgccgacg ccgcactgct cgacgccaag cgcagcggcc gcgacaaatg cgtgttcgcc       660
     gcgctcccgc cgcttcctgc cccttcccgc ccggctccag cgcgctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page