(data stored in ACNUC7421 zone)

EMBL: CP000438.PE173

CP000438.PE173       Location/Qualifiers
FT   CDS_pept        complement(192659..193039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15127"
FT                   /db_xref="InterPro:IPR018530"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UQ8"
FT                   /protein_id="ABJ15127.1"
FT                   /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDW
FT                   VERFLADGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNERV
FT                   AELAEEFREDCSFPFAIQAHDE"
     atgagtgacc tgcacatacc cggcacccag tccacgcccg ccatccaggg cgactggcag        60
     gccggacgcc tgtccatgca aggcgattcc tacccggaaa actcctatga actgttcggc       120
     caggtgatcg actgggtcga gcgcttcctc gccgacgggc agcggccgct ggaactggac       180
     ctgcgcctgc tgtacctgaa caccagttcg atcaaggcca tgatggacat cctcgacctg       240
     ctcgaagagg cccaccaggg cggtcgcccg gtcagcctgc gctggcacta cgaccggcgc       300
     aacgaacggg tcgccgagct ggccgaggag ttccgcgagg attgcagctt ccccttcgcc       360
     atccaggccc acgacgagta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page