(data stored in ACNUC7421 zone)

EMBL: CP000438.PE174

CP000438.PE174       Location/Qualifiers
FT   CDS_pept        complement(193066..193608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK93"
FT                   /protein_id="ABJ15128.1"
FT                   /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHAE
FT                   QAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLVER
FT                   DDGQSLVRSIQAIANLDKAALKAAYKEQLRRPRDSGCASGAGLGLLDIARKSSEPLAAS
FT                   LKEQPDGRAFFSLRAVI"
     atggaaacgc tagacctgct ggccatgcgt gaaagctaca cccgccaacg catcctgctc        60
     tgcttcaacg gaccgatctc gcgcagcctg atcgaggaga taggccacgc gctgcgcaac       120
     tacctgcacg ccgaacaggc caagccgagc gaagcgatgg acgtcttcgc ggtgtacatc       180
     gagatgaccc agaacatccg ccactacgcc aatctcaagg gctacggcga acacgaggcg       240
     gcggccacgg tagccatcgc ccgcaacgag gacggccact acgtggtgtc cgccggcaac       300
     ctggtggagc gcgacgacgg ccagagcctg gtgcgcagca tccaggccat cgccaacctc       360
     gacaaggccg ccctcaaggc cgcctacaag gagcagctac gccgcccgcg cgacagcggc       420
     tgcgccagcg gagccggtct cggcctgctg gacatcgccc gcaagtccag cgaaccactg       480
     gccgcatcgc tgaaggaaca gcccgacggg cgcgccttct tcagcctgcg cgccgtgatc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page