(data stored in ACNUC7421 zone)

EMBL: CP000438.PE193

CP000438.PE193       Location/Qualifiers
FT   CDS_pept        215908..218280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02410"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15147"
FT                   /db_xref="GOA:A0A0H2ZKC8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC8"
FT                   /protein_id="ABJ15147.1"
FT                   /translation="MKYHYRLPLRRTPPGGSDYALALLLALGGALPASAADAPAPAEEA
FT                   PPLAGSAPAKADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQVL
FT                   PSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIEQLE
FT                   LLRGPQGTLFGKNTTAGVLNISTRAPTFTTERTVEVSGGQDGYFQGRGTVSGPLGETLA
FT                   GRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEEDSSNG
FT                   SMVVYGAAERFWQRAALVGASPLRDPQRKKVNINGRQHVSVHQGGSSLEANWNLAGGYR
FT                   LTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFDYVVGAYA
FT                   FRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQGTWHLSERL
FT                   DFTAGLRGTYEEKNAKVERFAPLGGAAVGGVGAAVRNGQLGAYDSGDLSQYNFAPSALL
FT                   SLSYQFSDDLLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERANDAELGLKSTLF
FT                   DRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLEFEATALPLRGL
FT                   TLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLSGQRVVGASKWIANLNGEYQWR
FT                   LDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSDLGDGQLDTSVWLK
FT                   NAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
     atgaagtatc actaccgctt gccgctccgc cgaacgccgc ccggcggctc cgactacgcc        60
     ctggccctgc tgctcgccct cggcggtgcg ttgccggcca gtgccgccga tgctcccgcg       120
     cccgccgagg aggcgccgcc gctggccggc agcgcaccgg ccaaggccga tacggccctg       180
     ggcaaggtta ccgtcaccgc gcgtcgccgc gaggaggatt cgcagaaggt accgacgccg       240
     atcaccgtgc tcggtggcga gactctcgag gcccagcgca tctcccgggt gcaggacctg       300
     cagcaggtgc tgcccagcgt caatgtcgcc tacatccatg cgcggcagtc gagcgtcgcc       360
     gtgcgcggca tcggcaacaa ccccgccagc gacggcctgg aaggcagcgc cgggatctac       420
     ctcgacaacg tctacctggg gcggccggga atggccgtgt tcgacctgct ggacatcgag       480
     caactggagc tgctgcgcgg tccgcagggc accctgttcg gcaagaacac caccgccggg       540
     gtgctgaaca tcagcacccg cgcgccgacc ttcactaccg agcgcaccgt cgaggtctcc       600
     ggcgggcagg acggctactt ccagggccgc ggcacggttt ccgggccgct cggcgaaacc       660
     ctcgccggac gcctctcggc ctatcgcacc cgcgacgacg gctacatcaa gaacatccac       720
     gacgacaact atctcaacgg cggcgagcgc cagggcgcgc gcgggcaatt gctgttcgag       780
     ccgaacgagg acttcagcct gcgctggatc gccgactaca acgaggagga ttcgagcaac       840
     ggcagcatgg tggtctacgg cgccgccgag cgtttctggc agcgcgccgc gctggtcggc       900
     gcttcgccgt tgcgcgatcc gcagcgcaag aaggtcaaca tcaacggccg ccagcacgtc       960
     agcgtgcacc agggcggcag ctcgctggag gccaactgga acctcgccgg cggctaccgc      1020
     ctgacctcca tcagcgccta ccgctactgg cacttcaccc cggccaacga cgagcaactg      1080
     aacgtctcgg cgatcaacga caccggggtg gaagtgcacg accggcagtt ctcccaggag      1140
     atccgcctgg cctcgcccac cggcggtgcc ttcgactacg tggtgggcgc ctacgcgttc      1200
     aggcagaacc tcggcaacaa gaccttcacc tcctacggac cgttggccga cctgtacctg      1260
     ctcggcgcca atctcggcgc actgaacgac acctactcga aggccaacgg caagatcgag      1320
     accgacagct tcgcgctgtt cgcccagggc acctggcacc tcagcgaacg cctggacttc      1380
     accgccggcc tgcgcggtac ctacgaggag aagaacgcca aggtcgagcg cttcgctccg      1440
     ctgggcggcg cggcggtcgg cggggtcggc gcggcggtgc gcaacggcca gctcggtgcc      1500
     tacgattccg gcgatctcag ccagtacaac ttcgcccctt cggcgttgct cagcctcagc      1560
     taccagttca gcgacgacct gctcggctac gccagcctgt cccacggcga gaagtccggc      1620
     ggggtcaacc tggcggtggg cagcgcgccg agcgccggcg ccgattcgct gctggtcgga      1680
     ccggagcgcg ccaacgacgc cgagctgggc ctgaagagca cgctcttcga ccggcgcctg      1740
     ctgctcaacg ccaacctgtt ctggaccggc atccacggct accaggccac caccctgtac      1800
     caggcgccgg gctcgacgca gttggtgcag gtgctggcca acgccggcag cgtgcgctcg      1860
     cgcggcctgg aattcgaggc caccgcgctg ccgttgcgcg gcctgaccct gaacttcaac      1920
     ggctcttaca acgacgtcac ctacctgtcg ttcaaggatg ccccgtgccc tgcggaagtc      1980
     agcacccggc ccggcgcgcc gagcagttgc gacctcagcg ggcagcgcgt ggtcggcgcc      2040
     tcgaaatgga tcgccaacct caatggcgaa taccagtggc gcctcgacga ccgcttccaa      2100
     ccctacgtca gcgccagcta cgcctaccgc tccgcggccg agggcacgct ggacaactcc      2160
     gacctttcga agatcgacgg ctacgccctg gtgaacctcg ccgccggcct gcgcagcgat      2220
     ctcggcgacg gccaactgga cacctcggta tggctgaaga acgccttcga caaggactac      2280
     tacctgagcg ccttcgccag catcaacggc tcctacaccg catcggtggg acagccgcgc      2340
     acgctcggcg tatcgctgcg ctacgacttc tga                                   2373
//

If you have problems or comments...

PBIL Back to PBIL home page