(data stored in ACNUC7421 zone)

EMBL: CP000438.PE195

CP000438.PE195       Location/Qualifiers
FT   CDS_pept        219291..220190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15642"
FT                   /db_xref="GOA:A0A0H2ZLU3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLU3"
FT                   /protein_id="ABJ15642.1"
FT                   /translation="MSQSATARQPEPEVAEAFRITPLEAPLGAEVRGLDARRPLAPEQV
FT                   LALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPEIVKV
FT                   ANTGDGELGNFALPAHIDHQWTPVPSSGSLLYALEVPSSGGETRFTNLARAYESLDEAT
FT                   RREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRRVLFL
FT                   SAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHARNAFP
FT                   ASERRRLKRISLAGSRPF"
     atgagccaat ccgccaccgc ccggcaaccc gaacccgagg tcgccgaggc attccgcatc        60
     acccccctgg aggcgccgct gggcgccgaa gtccgtggcc tcgacgcgcg ccggccgctg       120
     gcgccggagc aggtcctggc gctcaagcag gcgctgcgcg agcaccacat cctggtgttc       180
     cgccagcagc acctcgacga tgagcagtac ttgcgcttcg ccaccctgtt cggctcggtg       240
     ttccagccgc cggcggacat cccggtgctg tcctcgggtg gcgacggcaa ggtgccggag       300
     atcgtcaagg tggccaacac cggcgacggc gaactgggca acttcgccct gccggcacac       360
     atcgaccacc aatggacgcc ggtgccgtcc tccggctcgt tgctctacgc gctggaggtg       420
     ccgtccagtg gcggcgagac gcgcttcacc aacctggcgc gcgcctacga gagcctcgac       480
     gaggcgaccc ggcgcgagat cgatggcctg cgcctgatca actacaaccc cttcatccgc       540
     ctgcgcgagg gcggctacgg cggcggtttc gccacctacc gcacgccgga catcgaaccg       600
     atccagggca gcgagcaccc actggtacgc acccacccgg aaagcggccg gcgcgtactg       660
     ttcctcagcg cccacaccga ggtggagatt cccggctacg accccgcgcg gggccaggcg       720
     ctgatcggtc gcctgcgcga acatctggcg cgcccggaac tgagctacag ccacgcctgg       780
     tcggtgggcg acatcgtctg gtgggacaac caggccgtgc tgcatgcgcg caacgccttc       840
     ccggccagcg agcggcggcg cctgaagcgc atcagcctgg cgggcagccg tccgttctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page