(data stored in ACNUC7421 zone)

EMBL: CP000438.PE196

CP000438.PE196       Location/Qualifiers
FT   CDS_pept        220837..221955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02450"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 1"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15149"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK8"
FT                   /protein_id="ABJ15149.1"
FT                   /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNASQ
FT                   PDSAYEAAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIARM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATVAEMKP
FT                   GSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNILDFLKL
FT                   TLNAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
     gtgcagatcg gtgtccccct cgagacccat gccggtgaga cgcgggtttc cgccaccccg        60
     gaaaccgtca agaagctgat cggccaaggc caccaggtga tcgtccagag cggcgccggc       120
     gtcaacgcca gccagccgga cagtgcctat gaagccgccg gcgcgacgat cggcagcgcc       180
     gccgaggcct tcggcgccga cctggtgctg aaggtggtcg cgcccagcgc cgccgagctg       240
     gcccagatga aaagcggtgc cgtgctggtc ggcatgctca accccttcga caacgagaac       300
     atcgcccgca tggccgagcg cggcatcacc gccttcgccc tcgaggccgc gccgcgtacc       360
     tcgcgggcgc agagcctgga tgtgctctcc tcgcaggcca acatcgccgg ctacaaggcg       420
     gtgatgctcg ccgccaacca ctacccgcgc ttcatgccga tgctgatgac cgccgccggc       480
     accgtgaagg ccgcccgcgt gctgatcctc ggcgccggcg tcgccggcct gcaggcgatc       540
     gccacggcca agcgcctggg cgcggtgatc gaagcttccg acgtgcgtcc ggcggtgaag       600
     gagcagatcg agtcgctcgg cgccaagttc gtcgacgtgc cctacgagac cgacgaagag       660
     cgcgagtgcg ccgaaggcgt cggcggctat gcgcggccga tgccggcctc gtggatggag       720
     cgccaggcca aggccgtgca cgagcgcgcc aagcagtcgg acatcgtcat cactaccgcg       780
     ctgatccccg gccgcaaggc gccgacgctg ctgcacgagg cgaccgtggc ggagatgaag       840
     ccgggctcgg tggtcatcga cctggccgcc gcccagggcg gcaactgccc gctgaccgag       900
     gccgaccagg tcgtggtccg gcacggcgtg accatcgtcg gccacagcaa cctggccgcg       960
     ctggtaccgg cggacgcctc ggcgctatac gcgcgcaaca tcctcgactt cctcaagctc      1020
     accctgaacg ccgaaggctt cagcgtgaac ctcgaggacg acatcgtcgc cgcctgcctg      1080
     atgtgccgcg acggccaggc ggtgcgcaag aacggctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page