(data stored in ACNUC7421 zone)

EMBL: CP000438.PE197

CP000438.PE197       Location/Qualifiers
FT   CDS_pept        222031..222339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02460"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 2"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15150"
FT                   /db_xref="GOA:A0A0H2ZK03"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK03"
FT                   /protein_id="ABJ15150.1"
FT                   /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH"
     atggatatca tttctgacgg gatctacaac ctgatcatct tcgtgctggc cgtgtacgtc        60
     ggctaccacg tggtatggaa cgtcacccct gccttgcaca ccccgctgat ggcggtgacc       120
     aacgcgattt ccgcgatcgt catcgtcggt gccatgctcg ccgccgccct gaccgtgacc       180
     ccgctgggca aggccatggg caccctcgcc gtggccttgg ccgcggtcaa tgtgttcggt       240
     ggcttcctgg tcacccggcg catgctggaa atgttcaaga agaaagcgcc gaaggcgggg       300
     ggccactga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page