(data stored in ACNUC7421 zone)

EMBL: CP000438.PE20

CP000438.PE20        Location/Qualifiers
FT   CDS_pept        21733..22758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00210"
FT                   /product="putative lysin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14976"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJL6"
FT                   /protein_id="ABJ14976.1"
FT                   /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISGK
FT                   FLRQPWKWPELWHANPQIQNPHLIYPGDTLSLVYVDGQPRLVLNRGESRGTIKLSPKIR
FT                   STPIAEAIPTIPLDKINSFLLANRIVDDEKTFTSAPYIVAGNAERIVSGTGDRIYARGK
FT                   FADGQPAYGIFRQGKVYIDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQEVRL
FT                   GDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGQRDGLAEGN
FT                   VLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYKKLSYALVLMASRPLSVTDRVQN
FT                   P"
     atgaggaaat cactagtcgc ccttctgctc cttgccgcga gcggtctggc gcaggcccag        60
     gtcgacctca gggaagggca tccggaccgc tacacggtgg tcaggggcga taccctgtgg       120
     gacatctcgg ggaaattcct ccgccagcca tggaagtggc cggaactctg gcacgccaac       180
     ccgcagatcc agaatcccca cctgatctac cccggcgaca ccctcagcct ggtctacgtc       240
     gatggccagc cgcgcctggt gctgaaccgt ggcgaatcgc gcgggaccat caagctgtcg       300
     ccgaagatcc gcagcacgcc gatcgccgag gctatcccga ccatcccgct ggacaagatc       360
     aacagcttcc tgctggccaa ccgcatcgtc gatgacgaga agaccttcac cagtgcgccg       420
     tacatcgtcg ccggcaacgc cgagcggatc gtcagcggca ccggcgaccg catctacgcc       480
     cgcggcaagt tcgccgacgg ccagccggcc tatggcatct tccgccaggg caaggtctac       540
     atcgatccga agaccaagga agtcctcggc atcaacgccg acgacatcgg cggcggcgag       600
     gtggtggcca ccgaaggcga cgtcgcgacc ctggcgctga cccgcaccac ccaggaagtg       660
     cgcctgggcg accgcctgtt ccccaccgag gagcgtgcgg tgaattccac cttcatgccc       720
     ggcgagccga gccgcgaggt gaagggcgaa atcatcgacg taccgcgcgg cgtgacccag       780
     atcggccagt tcgacgtggt caccctgaac cgtggccagc gcgacgggct ggccgagggc       840
     aacgtgctgg cgatctacaa ggtcggcgag acggtgcgcg accgcgttac cggtgagtcg       900
     gtgaagattc ccgacgaacg cgccggcctg ctgatggtgt tccgtaccta caagaagctg       960
     agctacgccc tggttctgat ggccagcagg ccgctctcgg taaccgacag ggtgcagaat      1020
     ccctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page