(data stored in ACNUC7421 zone)

EMBL: CP000438.PE202

CP000438.PE202       Location/Qualifiers
FT   CDS_pept        complement(226263..226475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15155"
FT                   /db_xref="InterPro:IPR021430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK08"
FT                   /protein_id="ABJ15155.1"
FT                   /translation="MAKKFPLHPSHPERICWGCDRYCSAESMGCGNGASRTQHPSELFG
FT                   EDWAGEWEVEGTEDAKEQEAPARQA"
     atggccaaga aatttcccct ccatcccagc cacccggagc gcatctgctg gggttgcgac        60
     cgctattgct cggcggaatc tatgggctgc ggcaacggcg ccagccgcac ccagcatccc       120
     agcgaactgt tcggcgagga ctgggccggt gaatgggaag tcgaaggaac ggaggacgcc       180
     aaggagcagg aggcgccggc acgccaggcc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page