(data stored in ACNUC7421 zone)

EMBL: CP000438.PE216

CP000438.PE216       Location/Qualifiers
FT   CDS_pept        238918..240351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02690"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15169"
FT                   /db_xref="GOA:A0A0H2ZKF1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF1"
FT                   /protein_id="ABJ15169.1"
FT                   /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGTA
FT                   GLGFIVPLGVAYLLALSYAFSFSELALMIPRAGSLSSYTEVAIGHFPAILATFSGYVVV
FT                   AMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALALLM
FT                   MIVLLVLGLGAVSSDHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLVEETR
FT                   RPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGEYGQLF
FT                   LVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFKQLSRRARTPWVAVLFVAAITG
FT                   LPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTPFYPLPQL
FT                   FGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLFVPEPLETA
FT                   GETAQGKSVALDPLQSPSA"
     atgaacgaca cgccgaacgt gcgtgagccg gccctgcgcc gcgtgctcgg gctgggaccg        60
     ctgctggcgg tggccatcgg cctggtggtt tcccagggcg tgatggtact gatgctgcaa       120
     ggtgccggga cggccggcct gggcttcatc gtgccgctgg gagtggccta cctgctggcg       180
     ctgagctacg ccttttcctt ttccgaactg gccctgatga ttccccgcgc cggtagcctt       240
     agcagctaca ccgaggtggc catcgggcat ttcccggcga tcctggcgac cttttccggc       300
     tacgtggtgg tggcgatgtt cgccctctcg gcggaactgc tgctgctcga cctgatcatc       360
     ggcaaggtct accccggcgc gctgccgccg atgctggtgg cctacggcgt gctcggcctg       420
     ttcaccctgc tcaacctgct cggcatcgac atcttcgcgc gcctgcagag cgccctggcg       480
     ctgctgatga tgatcgtcct gctggtgctc ggcctgggtg cggtgagcag tgaccacgct       540
     tccgcgcaga ctgccctggc gagcggctgg aacccgctcg gggtaagcgc cctggcgctc       600
     accgcgatgg ccgtgtgggg cttcgtcggc gccgagttcg tctgcccgct ggtggaggag       660
     acgcggcgtc cggagcgcaa tatcccgcgt tcgatgatcc tcggcctgag catcatcttc       720
     ctgaccatcg ccctctactg cttcggtgcg ctgctgtgca tcccgcaggc ggaactggcc       780
     ggcgacccgc tgccgcactt cctcttcgcc aaccgcgtgt tcggcgagta cggccagctg       840
     ttcctggtga tcgccgcgat caccgccacc tgcagcaccc tcaactcgtc gctggcggcg       900
     atcccgcgga tgctctacgg gatggcgcag aacggtcagg ccttcccgca attcaagcag       960
     ctcagccggc gggcgcgcac gccctgggtg gcggtgctgt tcgtcgccgc gatcaccggc      1020
     ctgccgatcc tgatcctcgg ccaggacccg gactcgatca acctgctgct gctcgccgcc      1080
     gcgctggcct ggctgctggc ctacatcatc gcccacgtcg acgtgctggc cctgcgccgt      1140
     cgctatccgc acatcgcccg tccgttccgc acgccgttct acccgctgcc gcaactgttc      1200
     ggcatcgccg ggatgatcta cgcggtggtc cacgtctcgc cgaccccgga aatgaccgga      1260
     cggatcttcg ccagcgccgg cgtggtgctg ggcgtggtct cgctggtggc ggtggtgtgg      1320
     atcaagggcg tgatgcgcaa gcccctcttc gtacccgaac cgctcgagac ggccggtgag      1380
     actgcccagg gcaagtccgt cgccctcgat cccctgcaat ccccttcggc ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page