(data stored in ACNUC7421 zone)

EMBL: CP000438.PE218

CP000438.PE218       Location/Qualifiers
FT   CDS_pept        241928..242986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02720"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15171"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN0"
FT                   /protein_id="ABJ15171.1"
FT                   /translation="MYKSLHQYAHVFSRLSLFGLAFAAAAQAQSQSLTVISFGGATKAA
FT                   QEQAYFKPFERSGGGQVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEGLF
FT                   ERLDPARFGDPAQFVPGTFSECGVATYVWSMVMAYDSTKLARAPQSWADFWNVREFPGK
FT                   RGLRKGAKYTLEVALLADGVKAEDLYKVLATPEGVSRAFAKLDQLKPNIQWWEAGAQPP
FT                   QWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALAEKFIA
FT                   FVSQPQTQKVFSEQIPYGPVHKGTLALLPKTVQEALPTAPANLEGARAVDAEFWVDHGE
FT                   ELEQRFNAWAAR"
     atgtacaagt ccttgcacca gtacgcacac gtgttttccc ggttgtccct gttcggcctg        60
     gcgttcgccg cggcggccca ggcgcagagc cagagcctga cggtgatctc cttcggcggc       120
     gcgaccaagg ccgcccagga gcaggcctat ttcaaaccct tcgagcgaag cggcggcggg       180
     caggtggtcg ccggcgaata caacggcgaa atggccaagg tgaaggccat ggtcgacgtc       240
     ggcaaggtca gctgggacgt ggtcgaggtg gagagccccg aactgctccg cggctgcgac       300
     gaggggctgt tcgaacgcct cgacccggcg cgtttcggcg accccgcgca gttcgtcccc       360
     ggcactttca gcgagtgcgg ggtggccacc tacgtctggt cgatggtgat ggcctacgac       420
     tcgacgaagc tggccagggc gccgcagtcc tgggcggatt tctggaacgt ccgcgagttc       480
     cccggcaagc gcggcctgcg caagggcgcc aagtacaccc tggaagtggc gctgctggcc       540
     gacggggtga aggcggagga cctctacaag gtactcgcca ccccggaggg ggtcagccgc       600
     gccttcgcca agctcgacca gctcaagccg aacatccagt ggtgggaggc cggcgcccag       660
     ccgccgcaat ggctggcggc cggcgacgtg gtgatgagcg cggcctacaa cgggcgcatc       720
     gccgctgcgc agaaggaggg ggtgaaactg gccatcgtct ggcccggcag tctctacgat       780
     ccggagtact gggcggtagt gaagggcacg ccgaacaagg cgctggcgga gaaattcatc       840
     gccttcgtca gccagccgca gacgcagaag gtgttctccg agcagatccc ctacgggccg       900
     gtacacaagg gcaccctggc gttgctgccg aagacggtgc aggaggcgct gccgaccgcg       960
     ccggccaacc tcgaaggcgc gcgggcggtg gatgccgagt tctgggtgga ccacggcgag      1020
     gagctggaac agcgtttcaa tgcctgggcg gcgcgctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page