(data stored in ACNUC7421 zone)

EMBL: CP000438.PE230

CP000438.PE230       Location/Qualifiers
FT   CDS_pept        253792..254625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15183"
FT                   /db_xref="GOA:A0A0H2ZJI0"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJI0"
FT                   /protein_id="ABJ15183.1"
FT                   /translation="MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNPD
FT                   KFAKRIYSFTHADGYRYGSNFFNLDVFLSDSRDPRKGTDHGGSEVYAVYRHQLYASRVF
FT                   DRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYREKN
FT                   HFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNRAAKFQGFVNYVGEKGEDYNDKDTAAE
FT                   TLVRTALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF"
     atgaagaaga tgatgcaggg cgccgccgcc ctgatcgcgc tcgtcggcgc cggggagagc        60
     atggcgctgg aatggatgag caacagcgtc ggtttccgct acggccagca attcaccaac       120
     ccgaacaacc cggacaagtt cgccaagcgc atctacagct tcacccacgc cgacggctat       180
     cgctacggca gcaatttctt caatctcgat gtgttccttt ccgacagccg cgacccgcgc       240
     aagggcaccg accacggtgg cagcgaggtc tatgcggtct accgccacca gctctacgcc       300
     tcgcgggtgt tcgaccggcc gctgggcacc ggcctggtca aggactacgc cttcaccctg       360
     ggcttcgacg ccagccgcaa caacaacctg gcttcggcca agaagcgcgc cctggtgttc       420
     ggcccgaccc tcaagttcaa tggtcccggc gtgctcgacc tgagcctgct ctactaccgc       480
     gagaagaacc acttcggcgt gcccggcgcg cgccatcccg accacacctt cgacaccacc       540
     tacatgctca acctgacctg gatgcggccg ttcaaggtcg gcaaccgtgc ggcgaagttc       600
     cagggcttcg tcaactacgt gggagagaag ggcgaggact acaacgacaa ggacaccgcg       660
     gcggaaaccc tggtccgcac cgccctgatg gtcgccgccc tgccaggcga caagcgccag       720
     ccgaacctgt ggctcggcgt cggctacgag tattggcaca acaagttcgg cgtcgacggc       780
     ggcaccggca gccgcacctc gacgccgacg ttgaacatgg aattcacctt ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page