(data stored in ACNUC7421 zone)

EMBL: CP000438.PE234

CP000438.PE234       Location/Qualifiers
FT   CDS_pept        258505..259320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15187"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK34"
FT                   /protein_id="ABJ15187.1"
FT                   /translation="MESRILSLAALTVLELSPPDMVEAAARAGYSHVGLRLVPATVEEH
FT                   HYPLLADAGLRRRTLARLRDSGVRTLDVEILRLRPDTRVGEFAAVLEVGAEFGARYVLV
FT                   AGNDDDERRSADNFAALCDLARPLGLDPHLEFMPWTGIRDLRQAARVVEAAARDNAGLL
FT                   LDAFHFDRSASSLEDLRAIPPARLGYAQLCDVVGPRPTSMDEILRQAREERRFPGDGGL
FT                   DLLALLRALPENLPLSLEVPALDLLARGVDGAERARLAIERTRALLARL"
     atggaatcga ggattctttc cctggcggcg ctcaccgtgc tcgagctgtc gcccccggac        60
     atggtcgagg ctgccgcccg tgccggctac agtcatgtcg gcctgcgcct ggtgccggcc       120
     accgtggaag agcaccacta tccgctgctg gccgatgccg gcctgcgccg gcggaccctg       180
     gcgcggctgc gcgacagcgg agtgcgcacg ctggacgtgg agatcctgcg cctgcgtccg       240
     gacacccgcg tcggcgagtt cgccgcggtg ctggaggtcg gcgccgagtt cggcgcgcgc       300
     tatgtgctgg tggccggcaa cgatgacgac gagcggcgca gcgcggacaa tttcgccgcg       360
     ttgtgcgacc tggcgcggcc gctcggcctc gatccgcacc tggagttcat gccctggacc       420
     gggatccgcg acctgcggca ggccgcacgg gtggtcgagg cggcggcgcg ggacaacgcc       480
     ggcctgttgc tggacgcctt ccatttcgac cgctcggcca gcagcctgga agacctgcgg       540
     gcgatcccgc ctgcgcgcct gggctacgcg caactctgcg atgtcgtcgg gccgcgtccg       600
     acgtcgatgg acgaaatcct tcgccaggcc cgcgaggaac ggcgtttccc tggcgatggc       660
     gggctcgatc tgctggcgct gctgcgcgcc ttgccggaga acctgccgct gagcctggag       720
     gtgcccgcgc tggatctgct cgcgcgcggc gtggatggcg cggagcgggc gcggctggcg       780
     atcgagcgga cccgggcgct gctcgcccgc ctgtag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page