(data stored in ACNUC7421 zone)

EMBL: CP000438.PE246

CP000438.PE246       Location/Qualifiers
FT   CDS_pept        complement(272125..272559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03090"
FT                   /product="putative CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15199"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI6"
FT                   /protein_id="ABJ15199.1"
FT                   /translation="MKTVAQLLNAKQNQQVYTIGPDEMVLDALRLMAEKNIGALLVVNH
FT                   GEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHLRH
FT                   LPVVEDGQLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
     atgaaaaccg tggcacaact gttgaacgcc aagcagaacc agcaggtgta caccatcgga        60
     ccggacgaga tggtgctcga cgccctgcgc ctgatggcgg aaaagaacat cggcgcgctg       120
     ctggtggtga accatggcga ggtggtcggg gtggtcagcg agcgcgacta cgcgcgcaag       180
     atggtcctca agggccgttc gtccatcggt acgccgatca gcgcgatcat gagcgcgccg       240
     gtggtcagcg tggactcgaa gcagagcgtc gacacctgca tgaacctgat gaccgatcgc       300
     cacctgcgcc acctgccggt cgtggaagac ggccagttgc tcggcctgct gtccatcggc       360
     gacctggtca aggcggcgat cgccgagcag gccgagctga tccagcaact ggaacagtac       420
     atccgcggcg actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page