(data stored in ACNUC7421 zone)

EMBL: CP000438.PE247

CP000438.PE247       Location/Qualifiers
FT   CDS_pept        complement(272724..273365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15200"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="InterPro:IPR037181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG4"
FT                   /protein_id="ABJ15200.1"
FT                   /translation="MNDYIARLREKYDDHFGCAPSIVLDCRDFWRHCVTAPEMAVFGYR
FT                   LESSRRPHHVVITAGMSQARMHFAPYMGSARWSSELICYLDVLGGEDLRHLQWLAGLPF
FT                   HERLALGHGHSVAFGFPLYEHSLLRHFLLLPTPLGEDAALFDGFDLSAHPVDLLWVVPL
FT                   TEQEYQVKVNKHLEGIAEVLNDAGHPLSLDRHRHCYVTGLRPEGFERILH"
     atgaacgact acatcgcccg gctgcgcgag aaatacgacg accatttcgg ctgtgcgccg        60
     agcatcgtcc tggactgccg tgacttctgg aggcactgcg tgacggcacc ggaaatggcg       120
     gtgttcggct accgcctgga aagcagccgg cgcccgcacc acgtggtgat caccgcgggg       180
     atgagccagg cacggatgca cttcgcgccc tatatgggca gcgcgcgctg gtccagcgag       240
     ctgatctgct accttgacgt cctcggcggt gaggacctgc gccacctgca gtggctcgcc       300
     ggcctgccgt tccacgaacg cctggccctc ggccacggac acagcgtggc attcggtttc       360
     ccgctctacg agcacagcct gctgcgtcac ttccttctcc tgccgacccc gctgggcgaa       420
     gatgccgccc tgttcgacgg tttcgacctg tccgcccatc cggtcgacct gctctgggtc       480
     gtgccgctaa ccgagcagga ataccaggtg aaagtgaaca agcacctgga aggcatcgcc       540
     gaagtgctga acgacgccgg acatccgctc agcctcgacc ggcatcgcca ttgctacgtc       600
     accggcctac gtccggaagg gttcgagcgg atactgcatt ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page