(data stored in ACNUC7421 zone)

EMBL: CP000438.PE248

CP000438.PE248       Location/Qualifiers
FT   CDS_pept        complement(273633..273920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU1"
FT                   /protein_id="ABJ15201.1"
FT                   /translation="MGGLRKPIRPAMPRHPHTTLLLCLCLTLPGCESGRSYSFSEDAPV
FT                   TGIRIQRDDRSPLQRLRDCERQGCSERQKIDPFTPDPDYLRAEGHFPLPW"
     atgggcggcc ttcgcaagcc cattcgaccc gcaatgccac gacacccgca caccaccctg        60
     ctcctctgcc tttgcctgac cctgcccggt tgcgagagcg gccgcagcta cagcttttcc       120
     gaggacgcgc ctgtcacagg catccgcatc cagcgcgacg accgctcgcc gttgcagcgc       180
     ctgcgggact gcgaacgcca gggttgcagc gagcggcaga agatcgaccc gttcaccccc       240
     gatcctgact acctgcgcgc ggaaggccac ttcccgctgc cctggtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page