(data stored in ACNUC7421 zone)

EMBL: CP000438.PE252

CP000438.PE252       Location/Qualifiers
FT   CDS_pept        complement(277003..277935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ0"
FT                   /protein_id="ABJ15205.1"
FT                   /translation="MRSWHGVVTKIAKQGKGAVVKNRLGPEELLVPFTVSTLVEVDLDA
FT                   RIYGTDVDDTPWAEGDERKEVLVGTEVELLTDTDTFPTHASQVLSANFRFALDIVKGGL
FT                   SGPVRKGAVLVIYHDFQQEIRRGDSGSAFAEAVVAYARNKLYKPAFAIKADTNYAQLVR
FT                   DLGKVAAESGEQYFIDTILIATHGTAGQLWLGNPHGDSTADVMARRVQGKQFVEPQAFG
FT                   ATLLELFGKELAIALYGCDFAGDEDGEAAALELRIAANARAVYAGKGTVYLNASKEGRS
FT                   TVTCSKAMVVYRTDKIEVLGGNQVPVFDI"
     atgcgctcat ggcatggcgt agtcacgaaa atcgccaagc aaggcaaggg cgccgtggtc        60
     aagaatcgac tcggcccgga agagcttctg gtgcccttca cagtgagtac gctcgtcgag       120
     gtcgacctgg acgcaaggat ctacggaacg gatgtggacg acacgccctg ggcggagggc       180
     gacgaacgaa aggaggtgct ggtcggtacc gaagtggaac tgctgaccga tacggatacc       240
     tttcctaccc atgcgtccca ggtgctcagc gccaatttcc gtttcgccct cgacatcgtc       300
     aagggagggc tcagcggccc ggtcaggaaa ggggcggtcc tggtcatcta ccacgacttc       360
     cagcaggaga tccggagagg cgactccggc agcgccttcg cggaggcggt cgtcgcctat       420
     gcgcggaaca agctctacaa gccggccttc gcgatcaagg ccgataccaa ctacgcccag       480
     ttggttcggg atctaggcaa ggttgccgcg gagagcggcg aacagtactt catcgatacg       540
     atcctcatcg ccacccacgg cacggctggc caactctggc tgggcaaccc ccacggcgat       600
     agcaccgcgg acgtcatggc ccggcgtgtc cagggcaagc agttcgtcga gccccaggcc       660
     tttggtgcga cccttctcga actgttcggc aaggaactgg ccatcgccct ctacgggtgc       720
     gacttcgccg gggacgagga cggagaagcg gcggccctcg agctgcgcat cgccgccaac       780
     gcgagagcgg tctacgccgg caagggcacg gtgtatctca atgccagcaa agagggtcgt       840
     tccacggtga cctgcagcaa ggcgatggtg gtctaccgga ccgacaagat cgaggtactg       900
     ggtggaaacc aggtaccggt attcgatatc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page