(data stored in ACNUC7421 zone)

EMBL: CP000438.PE253

CP000438.PE253       Location/Qualifiers
FT   CDS_pept        278510..279133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03163"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15668"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ8"
FT                   /protein_id="ABJ15668.1"
FT                   /translation="MSSPIIRHHLLHRLRDRQERFDVIFSEQKVAHMAAFFLASAEGPL
FT                   PHLTLIKLLYLADRESMARFDVPMSDDRAVSMPHGPVLSSTLDLIKGRLRSEVWSAWIS
FT                   PLVDHEVRLVHDVENWDDLDELSRSDRSILESVWQEFGHMTKYQLRDYTHHHIGEWHDP
FT                   HGSSRDIDPKDTFMALGQSEELAEIKARDLAERRRHGRKLSEFI"
     ttgagcagcc ccataatccg ccaccatttg ctacaccgcc taagggatag gcaagagagg        60
     tttgacgtga tcttcagtga acagaaagtg gctcacatgg cagctttctt tttggcgagt       120
     gccgaagggc cgctgcctca tctcacgctg atcaaactgc tgtacctggc agaccgagag       180
     tcgatggctc gtttcgacgt tcccatgtcg gacgatcgag ctgtttccat gccccatggg       240
     cctgtccttt cctcgacgct agacctcatc aaggggcgtt tgcgctctga ggtttggagc       300
     gcttggattt ctccgttggt ggatcacgag gtccgtctgg tccatgacgt ggagaattgg       360
     gacgatctgg atgagttgag ccgatcggat cgcagcattt tggaatcggt ctggcaagag       420
     tttggccaca tgaccaagta ccaattgcgg gactacaccc accatcacat tggtgagtgg       480
     cacgaccccc acggctcttc cagggacatt gatccaaagg atactttcat ggcgcttggt       540
     caaagcgagg agctggcgga gatcaaggcg cgcgatcttg ctgagcgccg tcggcacggt       600
     aggaagctgt ctgagttcat ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page