(data stored in ACNUC7421 zone)

EMBL: CP000438.PE254

CP000438.PE254       Location/Qualifiers
FT   CDS_pept        279133..279531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03166"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLW4"
FT                   /protein_id="ABJ15667.1"
FT                   /translation="MPGNVFQKGTLLIPTGGANHLHFVMNDPVYCPVLGYDAVLLVNIS
FT                   TVYPDKYFDQSCILKKGCHPFVLRDSWVVYREAGPFNLARLEQGVAQKSIKTHQPINAG
FT                   DFTRIRAGFDISPDVKIKVERFMRQHKI"
     atgccaggga acgtatttca gaagggaact ctgctaatcc ccaccggggg tgcgaatcac        60
     ctgcacttcg tgatgaatga ccccgtgtac tgcccggttc ttgggtatga cgcggtgttg       120
     cttgtcaaca tctcgactgt ctatccagat aagtatttcg atcagtcatg cattctaaag       180
     aagggttgtc atccctttgt tctgcgcgac agctgggtcg tataccgcga ggcaggccct       240
     ttcaaccttg cacggcttga gcaaggggta gcgcagaagt ccatcaagac gcatcagccc       300
     atcaacgcag gcgatttcac tcggattcgg gcaggcttcg acatctcgcc cgacgtcaaa       360
     atcaaagttg agcggttcat gaggcagcac aagatttag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page