(data stored in ACNUC7421 zone)

EMBL: CP000438.PE255

CP000438.PE255       Location/Qualifiers
FT   CDS_pept        complement(279718..280557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15206"
FT                   /db_xref="GOA:A0A0H2ZKU6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU6"
FT                   /protein_id="ABJ15206.1"
FT                   /translation="MQARTGISERRACQLIGLSRSVLRYQPRASVQNELQAQLVELAQE
FT                   RRRFGYRRLHILLRRAGVQVNHKRIYRLYRAAGLMVKRRRRRHGVAVERERLSLPSAPN
FT                   QVWSMDFVFDALSTGRRIKCLTVVDDFTKESVGILVEHGISGFRVTRALDEMARFRGYP
FT                   KASRTDQGPEFTGKALDQWAYQRDIKLKLIQPGKPTQNAFIKSFNGKFRDECLSEHWFY
FT                   SLAEARIRIAAWRRDYNEHRPHSAIGNLTPAEFAASWRTRQQQLKQEKLISTPGLTN"
     atgcaggcgc gaactggcat ctccgagcgt cgtgcctgtc agttgatcgg gctgtcccgc        60
     tcggtgttgc gctaccagcc gcgagccagt gtgcaaaacg agctgcaagc ccaactggtg       120
     gaactggccc aagagcgccg gcgctttggc tatcgccgcc tgcacatcct gctgcggcgt       180
     gctggcgtgc aggtcaacca caagcggatc tatcgcctgt accgcgctgc cggcttgatg       240
     gtgaaacggc ggcgccgccg ccatggcgtc gcggtggagc gcgaacgtct gagtttgccg       300
     agcgcaccaa accaggtctg gtcgatggac ttcgtcttcg atgcactgag caccgggcgg       360
     cggatcaaat gcctgacggt ggtcgatgac ttcaccaagg agtcggtcgg catcctggtg       420
     gagcacggta tcagcggctt tcgcgtcaca cgggcgctgg acgagatggc gcggtttcgc       480
     ggctacccga aagcgagccg caccgaccaa gggcccgagt tcaccggcaa ggcactcgat       540
     caatgggcct atcagcgcga catcaagctg aagctgattc agcctggtaa gcccacgcag       600
     aatgccttca tcaagtcgtt caacggtaag ttccgggacg aatgcctcag tgagcactgg       660
     ttctattcgc tggccgaagc gagaatccgc atcgcggcct ggcggcggga ttacaacgaa       720
     caccgaccgc acagcgcgat tggcaatctc accccggcag aatttgctgc aagttggcga       780
     actcgccagc agcagctgaa gcaggaaaaa ttaatatcaa ccccagggct tactaactag       840
//

If you have problems or comments...

PBIL Back to PBIL home page