(data stored in ACNUC7421 zone)

EMBL: CP000438.PE256

CP000438.PE256       Location/Qualifiers
FT   CDS_pept        complement(280590..280853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15207"
FT                   /db_xref="GOA:A0A0H2ZK68"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK68"
FT                   /protein_id="ABJ15207.1"
FT                   /translation="MKKRFTEEQTLDFLKQAEAGVPVKELCRRHGFSDASFYTWRAKFG
FT                   GMTVADAKRLKDLELENSRLKKLLAEAHLDIESLKVVARGKG"
     gtgaaaaagc gttttaccga agagcagact ctcgacttcc tcaagcaggc ggaggccggt        60
     gtgccggtga aggaactgtg tcgccgacac ggcttcagtg atgcctcgtt ctacacctgg       120
     cgggccaagt ttggcggtat gaccgtggcg gacgccaaac ggttgaagga tcttgaactg       180
     gaaaacagcc gattgaagaa gttgctcgcc gaggcccacc tcgacatcga gtcgctgaaa       240
     gtggtcgccc ggggaaaagg gtaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page