(data stored in ACNUC7421 zone)

EMBL: CP000438.PE257

CP000438.PE257       Location/Qualifiers
FT   CDS_pept        complement(280973..282415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15208"
FT                   /db_xref="InterPro:IPR021531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP5"
FT                   /protein_id="ABJ15208.1"
FT                   /translation="MSADAYHAPKTSPRLETLDVLSIGMSLDVFRQGQVWKALQEQNAV
FT                   QAEALHVGSILPMDPKKYPTSADDKDMAYEKRQADALELGLKNFLEKWPIPTVTVVRSW
FT                   DPSTPNLRFTPEETRESLSVKVNDLRVPAGLHWHRIANLQDGIICNDTPEGVLEALFSL
FT                   FERNPDLPAVLVYANEGFNMAGSLSSRDVPLKSLGGGSGPRVPGTLTDTMVALIVGRPE
FT                   RVDWLRQFAPYTKVNENRIDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDALPVL
FT                   ARLHRPVSVPLTRPDTGERLKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNATPLA
FT                   ELTPALGAAQSSLDLLDSRESYDLTQRLGDTGAASPFVGIALATMASYLNGDSSMVMPL
FT                   RRKDQATLIGISSPTPGKKPAHDPFGVDLLPQTASGDGPPPSADPVAPASRLTTRLPPG
FT                   EDYALEEFLSSLKPSTDWQDDL"
     atgtccgctg atgcttatca cgctccgaaa acttcgccgc gcctggaaac cctggatgtg        60
     ctcagcatag gcatgagcct ggatgtgttt cgccagggcc aggtatggaa ggccttgcag       120
     gagcagaatg cggtgcaggc cgaggccttg catgtcggca gcatcctgcc gatggacccg       180
     aagaagtatc cgacgtctgc ggatgacaag gatatggcgt atgaaaagcg ccaagcggac       240
     gccctggaac tggggctgaa aaactttctg gagaaatggc cgataccaac ggtgacggtg       300
     gtgcgtagtt gggatccgag cactcctaac ctacgcttca ctccggagga gacgcgggaa       360
     agcctgtcag taaaagtcaa tgatctccgt gttccggctg gactgcattg gcatcggatt       420
     gccaatttgc aggatggcat tatctgtaac gatacgcctg aaggagtact ggaggcgttg       480
     ttcagtttgt tcgaacgcaa cccagacttg ccagcagtgt tggtgtacgc caacgaaggc       540
     ttcaatatgg ccggttcctt atcgagtcgg gatgtacctt taaaatcatt agggggaggt       600
     tctggcccac gtgtaccggg gaccttgaca gacaccatgg tcgccctgat cgtcggccgc       660
     cccgagcggg tcgactggct acgccagttc gccccctaca ccaaggtcaa cgaaaaccgg       720
     atcgaccccg agttccgtgg ctggggctgg cgcaagccgc cggtggagtt ccgccccacg       780
     ccgttcattc cccagccctg gaccgagcgg gctctggagc agtgggatgc gttgccggtg       840
     ctggccaggc tgcatcggcc ggtgagtgtg ccgctgaccc gcccggatac cggcgaacgg       900
     ctcaagcgcg aagctctcac cgcacaactg gccgctgcct ggaagacggc cagtgccggg       960
     ctcaggccgg cgcccgcccg gctgttctac gacggcgggt tgaacgccac gccgctggcc      1020
     gaactcaccc cggcgctggg cgccgcgcag agttcgctgg acttgctgga ctcgcgggaa      1080
     agctacgacc tgacccagcg cctgggcgac accggcgcgg cctcgccctt cgttggcatc      1140
     gccctggcga ccatggccag ctacctcaac ggcgacagca gcatggtgat gccgttgcgg      1200
     cgcaaggacc aggcgaccct gatcggcatc agctcgccga cgcctgggaa gaagcccgct      1260
     cacgacccgt tcggcgtcga cctgctgccg cagaccgcca gcggcgacgg tccgccgcca      1320
     tcggccgacc cggtggcgcc cgccagtcgg ctcacgaccc ggttgccgcc cggcgaagac      1380
     tatgccctgg aagagttcct gagcagcctc aaacccagca ccgactggca ggacgatttg      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page