(data stored in ACNUC7421 zone)

EMBL: CP000438.PE258

CP000438.PE258       Location/Qualifiers
FT   CDS_pept        complement(282565..284715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15209"
FT                   /db_xref="InterPro:IPR021692"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN3"
FT                   /protein_id="ABJ15209.1"
FT                   /translation="MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDL
FT                   AGCYERIERGLCQGLNERLDMPPTLPGGQANPGYLTPAGYSLPADDEGKAENPDAVYYR
FT                   RKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGGQFV
FT                   NATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIR
FT                   KRYPDDTINVVGHSQGTLLTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWS
FT                   SQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQGYGAIGGPGWVGGLGCQTTID
FT                   GERLSFDERDNRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQR
FT                   IFTVRKRNGEKEKIGGHAPPHVYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTA
FT                   PRLPLPTEARFDFDGTVTAPGENSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVA
FT                   QQVDTALAYRYGRDTRSVERALNEGKELARQTHVFSARELGTGMVLVTRAETPYEARLR
FT                   LQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDW
FT                   KAKDKGLNGQANDEIHIPSEEVQALYHAEEPKNSELIDATVVYRKSGKLPVTVGDSLPS
FT                   LVATQTIEDRYYSRPVRFGGAS"
     atgaacgata gggttcggtc gaggacgatc gtctctgccc agtccatcac cttgcccaag        60
     ggcggcgacg tgcacctggt gccgcctccg cccaagcctt gcgtgaccat cgtggtgcat       120
     ggcgtcaacg atctcgcggg ttgctacgaa cggatcgagc gagggctctg ccaggggctc       180
     aacgaacgcc tggacatgcc gccgaccttg cccggcgggc aggccaatcc cggctacctg       240
     acgccggcgg gctacagcct gccggcggac gacgaaggca aggcggagaa ccccgacgcc       300
     gtctactacc ggcgcaagtt cgccagtggc gccggcgggg ccgccgtacg cagcgtagtc       360
     gtacctttct actggggctt ccgcgaggaa gagcaataca tcaacaagac cgcggcccac       420
     ggcgaatggc tggaccgcaa cggcaaccgg ctggacaagt ccggcaccaa ggaaggcggg       480
     cagttcgtca atgccaccac caacctgccg gacatgtggg gccagggttt caacggcaag       540
     ctgttcggtt tcatctcgct ggactggttc ggcggcacca tgacccatcc gctgttttcg       600
     gcggcagggc gcaagtacat ggtccttgcg gccatgcgcc tggccatgtt gatcaagatc       660
     atccgcaagc gttacccgga cgacaccatc aatgtcgtcg ggcacagcca gggcaccctg       720
     ttgaccctgc tggcacatgc cttcctcaag gatgacggcg tggcgccggc ggacggggtg       780
     atcatgctca actcacccta cggcctgttc gaacccctca acgagaagct ccagggctgg       840
     agcagccagc agaccagaga ggcgcggctg gccacgctca aaggcatcct cgagttcatc       900
     tgcggccggc gccatccggt ccccgcgctg agcagcgtcg cgttgcgcaa ctgccaaggc       960
     tacggcgcga taggcggtcc cggctgggtg ggtggcctgg gctgccagac gaccatcgac      1020
     ggggaacggc tcagcttcga tgagcgcgac aatcgcggca gtgtctacct gtatttcacg      1080
     ccccaggacc agacggtggg acttgccaac gtccagggta tcggctggcg cggcattgct      1140
     gagcaggtca aggggctccc gggaaggacc gggctgccgc agggttttca ccagcgcatc      1200
     ttcaccgtac gcaagcgcaa tggcgagaag gaaaagatcg gcgggcacgc ccctccccat      1260
     gtctaccctc ttctgctggc cggcgagaag acctgggaag acaccgggct gggcggcaag      1320
     gacagattcg gccgggcgaa cttcgaccag ggcgacagcg tgctgctgac cgcgccgcgt      1380
     ctgccgttgc cgacggaagc gcgattcgat ttcgacggaa ccgtcacggc gccgggagag      1440
     aactccgcca gcggcgtcta tcaggtgcgc gataccctcg atccgatcga cgccgccatc      1500
     ggcgtaagca acggcggctg gaaggaaaag gacagcgggc atgccgtcgc gcaacaggtg      1560
     gacaccgcgc tggcgtaccg ctacgggcgc gacacgcgca gcgtggagag ggcgttgaac      1620
     gaaggcaagg aactggcccg gcagacccat gtgttttccg ctcgtgaact gggcaccggc      1680
     atggttctgg tcacccgcgc ggaaactccc tacgaggccc ggctgcgcct gcagacggcg      1740
     gagggccatc tggagccctt gtcgttccac tcggccatac ccaacaaccc ggagcataac      1800
     cggcgggtac tggcctatga cctggccatc ggggccgggg acagcgtgga tgatgtggtt      1860
     ttctatcagt atctgtgtcg agtggcggat tggcggttgg attggaaggc taaggacaag      1920
     gggctaaatg gccaagcaaa tgacgaaata catattccga gcgaagaggt gcaagcgttg      1980
     tatcacgcgg aagagcctaa aaatagcgag ctaatagacg ccactgtagt ctaccgcaag      2040
     agtggcaaac tccctgtgac agtaggagac agcctgcctt ccttggtggc gacacaaacc      2100
     atcgaagacc gctattacag ccggccggtg cgttttggag gagcgagctg a               2151
//

If you have problems or comments...

PBIL Back to PBIL home page