(data stored in ACNUC7421 zone)

EMBL: CP000438.PE259

CP000438.PE259       Location/Qualifiers
FT   CDS_pept        complement(284712..285209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ3"
FT                   /protein_id="ABJ15210.1"
FT                   /translation="MKCKTLLIACLFGLGSVQALAVSKLPPQIPVHAGSGRVTLDLRPL
FT                   LAETNDVEITRVSVCRRVGSHCQETLWRIELPPGWRAGEIEVFGDYPGSSVLLRRPERL
FT                   QPDGSYNAFIHFNERSRRHRQTVSSIAVEFCLAGEPGNWMLLDEATCLARRNAEERQGE
FT                   KP"
     atgaaatgca agaccttgct cattgcctgc ctgttcggcc tgggaagcgt ccaggccctg        60
     gccgtttcca aactgccacc gcagatcccg gtgcacgccg gctccgggcg cgtgaccctg       120
     gatctacgcc ccttgctggc ggaaaccaac gacgtcgaga tcacccgtgt ttcggtatgt       180
     cggcgggtcg gcagccattg ccaggaaacg ctgtggcgga tcgagctccc gcccgggtgg       240
     cgtgccgggg agatcgaggt cttcggcgac tatcccggct ccagcgtgct cctgcgccgg       300
     ccggagcgct tgcagccaga tgggagctac aacgcattca ttcatttcaa cgagcgtagc       360
     cgtcggcacc ggcaaacggt ttccagcatt gccgtcgaat tctgcctggc cggcgaacct       420
     ggcaactgga tgctgctcga cgaagcgacc tgcctggcac gacgcaacgc cgaggagcgg       480
     caaggagaga agccatga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page